Psyllid ID: psy14775

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13

MALSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD

ccccEEEEEcccccHHHHHHHHHcHHHHHHHHHccccEEEEEEEcccccccccccccEEEEEEccccHHHHHHHccEEEEEccccHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHcccEEEEEcc

ccccEEEEEEccccHHHHHHHHccHHHHHHHHHccccEEEEEEcccccccccccccEEEEEEEccccHHHHHHHccEEEEcccHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHHcccEEEEccc

MALSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQhgngdikpnitesgltvhsydykssisediessDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD

MALSQVFVTvgttkfdelidKIQSKEILKILKSKGCKKLIIqhgngdikpnitesGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD

MALSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKssisediessdLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD

****QVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCV**

*ALSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD

MALSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD

**LSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MALSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		129	2.2.26 [Sep-21-2011]
Q9D8C3		1166	UDP-N-acetylglucosamine t	yes	N/A	0.953	0.105	0.492	4e-29
Q9NP73		1137	UDP-N-acetylglucosamine t	yes	N/A	0.937	0.106	0.491	7e-29
Q5I0K7		165	UDP-N-acetylglucosamine t	yes	N/A	0.961	0.751	0.464	2e-28
O14190		162	UDP-N-acetylglucosamine t	yes	N/A	0.906	0.722	0.432	3e-21
Q5ABE5		293	UDP-N-acetylglucosamine t	N/A	N/A	0.961	0.423	0.335	3e-14
P53178		202	UDP-N-acetylglucosamine t	yes	N/A	0.953	0.608	0.346	3e-13
Q6C3P1		196	UDP-N-acetylglucosamine t	yes	N/A	0.844	0.556	0.339	4e-13
Q4WQN1		197	UDP-N-acetylglucosamine t	yes	N/A	0.937	0.614	0.358	2e-12
Q6FVR6		198	UDP-N-acetylglucosamine t	yes	N/A	0.945	0.616	0.305	1e-11
P0CN88		200	UDP-N-acetylglucosamine t	no	N/A	0.937	0.605	0.282	5e-10

>sp\|Q9D8C3\|ALG13_MOUSE UDP-N-acetylglucosamine transferase subunit ALG13 homolog OS=Mus musculus GN=Alg13 PE=2 SV=2	Back alignment and function desciption

 Score =  126 bits (317), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 89/126 (70%), Gaps = 3/126 (2%)

Query: 3   LSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDI--KPNITESGLTVH 60
           + + FVTVGTT FDEL+ ++ + + ++IL+S G   L++Q G G +  KP  TES  T+ 
Sbjct: 1   MKRAFVTVGTTSFDELVARVVANDCVQILESLGYNHLVLQVGRGTVVPKPFRTES-FTLD 59

Query: 61  SYDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHEL 120
            Y YK S+ ED++ +DLVI+HAGAG+ LE LE GK L+ VVN+ LM+NHQ ELA++ H+ 
Sbjct: 60  VYRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKE 119

Query: 121 GYSLYC 126
           G+  YC
Sbjct: 120 GHLFYC 125

Isoform 2 may be involved in protein N-glycosylation, second step of the dolichol-linked oligosaccharide pathway (By. similarity).
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 4EC: 1

>sp\|Q9NP73\|ALG13_HUMAN UDP-N-acetylglucosamine transferase subunit ALG13 homolog OS=Homo sapiens GN=ALG13 PE=1 SV=2	Back alignment and function description

>sp\|Q5I0K7\|ALG13_RAT UDP-N-acetylglucosamine transferase subunit ALG13 homolog OS=Rattus norvegicus GN=Alg13 PE=1 SV=1	Back alignment and function description

>sp\|O14190\|ALG13_SCHPO UDP-N-acetylglucosamine transferase subunit alg13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg13 PE=3 SV=1	Back alignment and function description

>sp\|Q5ABE5\|ALG13_CANAL UDP-N-acetylglucosamine transferase subunit ALG13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG13 PE=3 SV=1	Back alignment and function description

>sp\|P53178\|ALG13_YEAST UDP-N-acetylglucosamine transferase subunit ALG13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG13 PE=1 SV=1	Back alignment and function description

>sp\|Q6C3P1\|ALG13_YARLI UDP-N-acetylglucosamine transferase subunit ALG13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG13 PE=3 SV=1	Back alignment and function description

>sp\|Q4WQN1\|ALG13_ASPFU UDP-N-acetylglucosamine transferase subunit alg13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg13 PE=3 SV=2	Back alignment and function description

>sp\|Q6FVR6\|ALG13_CANGA UDP-N-acetylglucosamine transferase subunit ALG13 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG13 PE=3 SV=1	Back alignment and function description

>sp\|P0CN88\|ALG13_CRYNJ UDP-N-acetylglucosamine transferase subunit ALG13 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG13 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		129
334350369		165	PREDICTED: UDP-N-acetylglucosamine trans	0.961	0.751	0.504	7e-30
410913575		164	PREDICTED: UDP-N-acetylglucosamine trans	0.961	0.756	0.536	8e-30
348563643		1119	PREDICTED: UDP-N-acetylglucosamine trans	0.961	0.110	0.504	9e-30
348563641		165	PREDICTED: UDP-N-acetylglucosamine trans	0.961	0.751	0.504	2e-29
238231523		164	UDP-N-acetylglucosamine transferase subu	0.976	0.768	0.503	4e-29
363732656		1126	PREDICTED: UDP-N-acetylglucosamine trans	0.961	0.110	0.488	2e-28
213515574		164	UDP-N-acetylglucosamine transferase subu	0.976	0.768	0.496	3e-28
170053244		170	UDP-N-acetyl glucosamine transferase sub	0.945	0.717	0.511	3e-28
291390976		165	PREDICTED: asparagine-linked glycosylati	0.937	0.733	0.516	3e-28
47225283		164	unnamed protein product [Tetraodon nigro	0.961	0.756	0.504	3e-28

>gi\|334350369\|ref\|XP_003342343.1\| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Monodelphis domestica]	Back alignment and taxonomy information

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 1/125 (0%)

Query: 3   LSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPN-ITESGLTVHS 61
           +  VFVTVGTT FDEL+  + S+  L+IL+  G +KL++Q G G + P+    +  ++  
Sbjct: 1   MKSVFVTVGTTSFDELVACVSSRATLQILRRLGYRKLVLQIGKGRVVPDSFASTTFSLIV 60

Query: 62  YDYKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELG 121
           Y YK+S+ EDI+ +DL+I+HAGAG+ LE LE GK L+ VVN+ LMDNHQLELA++ H+ G
Sbjct: 61  YRYKNSLKEDIKRADLIISHAGAGSCLEALEEGKPLVVVVNEKLMDNHQLELARQLHKEG 120

Query: 122 YSLYC 126
           Y  YC
Sbjct: 121 YLFYC 125

Source: Monodelphis domestica

Species: Monodelphis domestica

Genus: Monodelphis

Family: Didelphidae

Order: Didelphimorphia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi\|410913575\|ref\|XP_003970264.1\| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Takifugu rubripes]	Back alignment and taxonomy information

>gi\|348563643\|ref\|XP_003467616.1\| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 homolog isoform 2 [Cavia porcellus]	Back alignment and taxonomy information

>gi\|348563641\|ref\|XP_003467615.1\| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 homolog isoform 1 [Cavia porcellus]	Back alignment and taxonomy information

>gi\|238231523\|ref\|NP_001154175.1\| UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Oncorhynchus mykiss] gi\|225704602\|gb\|ACO08147.1\| UDP-N-acetylglucosamine transferase subunit alg13 [Oncorhynchus mykiss]	Back alignment and taxonomy information

>gi\|363732656\|ref\|XP_420312.3\| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Gallus gallus]	Back alignment and taxonomy information

>gi\|213515574\|ref\|NP_001134591.1\| UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Salmo salar] gi\|209734518\|gb\|ACI68128.1\| UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Salmo salar]	Back alignment and taxonomy information

>gi\|170053244\|ref\|XP_001862584.1\| UDP-N-acetyl glucosamine transferase subunit alg13 [Culex quinquefasciatus] gi\|167873839\|gb\|EDS37222.1\| UDP-N-acetyl glucosamine transferase subunit alg13 [Culex quinquefasciatus]	Back alignment and taxonomy information

>gi\|291390976\|ref\|XP_002711985.1\| PREDICTED: asparagine-linked glycosylation 13 homolog [Oryctolagus cuniculus]	Back alignment and taxonomy information

>gi\|47225283\|emb\|CAG09783.1\| unnamed protein product [Tetraodon nigroviridis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		129
UNIPROTKB\|F1NRT1		165	Gga.11386 "Uncharacterized pro	0.961	0.751	0.456	9.7e-25
UNIPROTKB\|K7GKK3		151	K7GKK3 "Uncharacterized protei	0.930	0.794	0.471	1.4e-23
UNIPROTKB\|K7GM15		165	K7GM15 "Uncharacterized protei	0.930	0.727	0.471	1.4e-23
RGD\|1359416		165	Alg13 "asparagine-linked glyco	0.961	0.751	0.432	1.4e-23
UNIPROTKB\|D6RE84		222	ALG13 "UDP-N-acetylglucosamine	0.930	0.540	0.471	1.8e-23
UNIPROTKB\|F1MU60		165	F1MU60 "Uncharacterized protei	0.930	0.727	0.471	3.8e-23
UNIPROTKB\|E2RPL3		165	LOC100856287 "Uncharacterized	0.937	0.733	0.442	3.8e-23
MGI\|MGI:1914824		1166	Alg13 "asparagine-linked glyco	0.953	0.105	0.460	9.9e-23
UNIPROTKB\|F1RWU1		1122	F1RWU1 "Uncharacterized protei	0.930	0.106	0.471	3.2e-22
UNIPROTKB\|Q9NP73		1137	ALG13 "UDP-N-acetylglucosamine	0.930	0.105	0.471	4.2e-22

UNIPROTKB\|F1NRT1 Gga.11386 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

 Score = 282 (104.3 bits), Expect = 9.7e-25, P = 9.7e-25
 Identities = 57/125 (45%), Positives = 80/125 (64%)

Query:     3 LSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHS- 61
             +  VFVTVGTT FDELI  + S    ++L+S+GC++L++Q G G ++P        V   
Sbjct:     2 MKTVFVTVGTTSFDELIAAVSSPAAEQVLRSRGCRQLVLQIGRGALQPAPQYGPAFVRDV 61

Query:    62 YDYKXXXXXXXXXXXLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELG 121
             + +K           LVI+HAGAG+ LE LE GK L+ V+N+ LMDNHQLELA++ H+ G
Sbjct:    62 FRFKESLAEDLRRADLVISHAGAGSCLETLEEGKPLLVVINEKLMDNHQLELARQLHKDG 121

Query:   122 YSLYC 126
             + LYC
Sbjct:   122 HVLYC 126

GO:0016758 "transferase activity, transferring hexosyl groups" evidence=IEA

GO:0030246 "carbohydrate binding" evidence=IEA

GO:0030259 "lipid glycosylation" evidence=IEA

UNIPROTKB\|K7GKK3 K7GKK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|K7GM15 K7GM15 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|1359416 Alg13 "asparagine-linked glycosylation 13" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|D6RE84 ALG13 "UDP-N-acetylglucosamine transferase subunit ALG13 homolog" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MU60 F1MU60 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RPL3 LOC100856287 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:1914824 Alg13 "asparagine-linked glycosylation 13" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RWU1 F1RWU1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9NP73 ALG13 "UDP-N-acetylglucosamine transferase subunit ALG13 homolog" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q4WQN1	ALG13_ASPFU	2, ., 4, ., 1, ., 1, 4, 1	0.3586	0.9379	0.6142	yes	N/A
O14190	ALG13_SCHPO	2, ., 4, ., 1, ., 1, 4, 1	0.432	0.9069	0.7222	yes	N/A
Q5I0K7	ALG13_RAT	2, ., 4, ., 1, ., 1, 4, 1	0.464	0.9612	0.7515	yes	N/A
P53178	ALG13_YEAST	2, ., 4, ., 1, ., 1, 4, 1	0.3461	0.9534	0.6089	yes	N/A
Q6FVR6	ALG13_CANGA	2, ., 4, ., 1, ., 1, 4, 1	0.3057	0.9457	0.6161	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.4.1	0.766
4th Layer	2.4.1.141	0.824
3rd Layer	2.7.2	0.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		129
COG5017		161	COG5017, COG5017, Uncharacterized conserved protei	6e-27
pfam04101		167	pfam04101, Glyco_tran_28_C, Glycosyltransferase fa	3e-25
COG0707		357	COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acety	6e-07

>gnl\|CDD\|227350 COG5017, COG5017, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

 Score = 97.6 bits (243), Expect = 6e-27
 Identities = 52/129 (40%), Positives = 77/129 (59%), Gaps = 13/129 (10%)

Query: 6   VFVTVGTT--KFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNITESGLTVHSYD 63
           +FVTVG+T   F+ L+ KI+  E+ +       ++LI+Q+GNGDIKP    +GL V+ +D
Sbjct: 2   IFVTVGSTFYPFNRLVLKIEVLELTE----LIQEELIVQYGNGDIKP---VAGLRVYGFD 54

Query: 64  YKSSISEDIESSDLVIAHAGAGTSLEVLEAGKLLITVVN----QSLMDNHQLELAQKFHE 119
            +  I   I  + +VI+HAG G+ L +L   K LI V      Q L+D+HQ+ELA K  E
Sbjct: 55  KEEKIQSLIHDARIVISHAGEGSILLLLRLDKPLIVVPRSSQYQELVDDHQVELALKLAE 114

Query: 120 LGYSLYCVP 128
           + Y + C P
Sbjct: 115 INYVVACSP 123

Length = 161

>gnl\|CDD\|217893 pfam04101, Glyco_tran_28_C, Glycosyltransferase family 28 C-terminal domain	Back alignment and domain information

>gnl\|CDD\|223779 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		129
2ks6_A		201	Nmr Solution Structure Of Alg13 --- Obtained With I		1e-11
2jzc_A		224	Nmr Solution Structure Of Alg13: The Sugar Donor Su		1e-11

>pdb|2KS6|A Chain A, Nmr Solution Structure Of Alg13 --- Obtained With Iterative Cs-Rosetta From Backbone Nmr Data Length = 201

Back alignment and structure

Iteration: 1

Score = 65.1 bits (157), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 51/156 (32%), Positives = 68/156 (43%), Gaps = 33/156 (21%) Query: 6 VFVTVGTT-KFDELIDKIQSKEILKILKSKGCKKLIIQHG---NGDIKPNITESG----- 56 +FVT G T F +L+ + S E + L G +LIIQ G + + + + E G Sbjct: 8 LFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERGGQRES 67 Query: 57 -----------------------LTVHSYDYKXXXXXXXXXXX-LVIAHAGAGTSLEVLE 92 L V +D+ LVI+HAG G+ L+ L Sbjct: 68 QKIPIDQFGCGDTARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLR 127 Query: 93 AGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVP 128 K LI VN SLMDNHQ ++A KF ELGY C P Sbjct: 128 LNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAP 163

PyMOL of 2ks6

>pdb|2JZC|A Chain A, Nmr Solution Structure Of Alg13: The Sugar Donor Subunit Of A Yeast N-Acetylglucosamine Transferase. Northeast Structural Genomics Consortium Target Yg1 Length = 224

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		129
2jzc_A		224	UDP-N-acetylglucosamine transferase subunit ALG13;	9e-35
2p6p_A		384	Glycosyl transferase; X-RAY-diffraction,urdamycina	8e-04

>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Length = 224	Back alignment and structure

 Score =  119 bits (298), Expect = 9e-35
 Identities = 52/162 (32%), Positives = 68/162 (41%), Gaps = 33/162 (20%)

Query: 1   MALSQVFVTVGTT-KFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKPNI------- 52
           +    +FVT G T  F +L+  + S E  + L   G  +LIIQ G               
Sbjct: 26  IEEKALFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERG 85

Query: 53  ------------------------TESGLTVHSYDYKSSISEDIES-SDLVIAHAGAGTS 87
                                       L V  +D+ + +   I   SDLVI+HAG G+ 
Sbjct: 86  GQRESQKIPIDQFGCGDTARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSI 145

Query: 88  LEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVPD 129
           L+ L   K LI  VN SLMDNHQ ++A KF ELGY   C P 
Sbjct: 146 LDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAPT 187

PyMOL of 2jzc

>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		129
2jzc_A		224	UDP-N-acetylglucosamine transferase subunit ALG13;	99.96
3s2u_A		365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape	99.93
3hbm_A		282	UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je	99.87
2o6l_A		170	UDP-glucuronosyltransferase 2B7; drug metabolism,	99.86
1rrv_A		416	Glycosyltransferase GTFD; GT-B, glycosyltransferas	99.82
3h4t_A		404	Glycosyltransferase GTFA, glycosyltransferase; van	99.82
2iya_A		424	OLEI, oleandomycin glycosyltransferase; carbohydra	99.81
1iir_A		415	Glycosyltransferase GTFB; rossmann fold; 1.80A {Am	99.8
3rsc_A		415	CALG2; TDP, enediyne, structural genomics, PSI-2,	99.8
2yjn_A		441	ERYCIII, glycosyltransferase; transferase, cytochr	99.8
3ia7_A		402	CALG4; glycosysltransferase, calicheamicin, enediy	99.79
4amg_A		400	Snogd; transferase, polyketide biosynthesis, GT1 f	99.78
3oti_A		398	CALG3; calicheamicin, TDP, structural genomics, PS	99.76
2c1x_A		456	UDP-glucose flavonoid 3-O glycosyltransferase; WIN	99.76
4fzr_A		398	SSFS6; structural genomics, PSI-biology, protein s	99.76
3otg_A		412	CALG1; calicheamicin, TDP, structural genomics, PS	99.74
2iyf_A		430	OLED, oleandomycin glycosyltransferase; antibiotic	99.74
2p6p_A		384	Glycosyl transferase; X-RAY-diffraction,urdamycina	99.73
2acv_A		463	Triterpene UDP-glucosyl transferase UGT71G1; glyco	99.72
2pq6_A		482	UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl	99.72
3hbf_A		454	Flavonoid 3-O-glucosyltransferase; glycosyltransfe	99.7
3tsa_A		391	SPNG, NDP-rhamnosyltransferase; glycosyltransferas	99.69
2vch_A		480	Hydroquinone glucosyltransferase; glycosyltransfer	99.69
1f0k_A		364	MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe	99.55
3ot5_A		403	UDP-N-acetylglucosamine 2-epimerase; structural ge	98.76
3dzc_A		396	UDP-N-acetylglucosamine 2-epimerase; structural ge	98.6
1v4v_A		376	UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t	98.56
4hwg_A		385	UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc	98.51
1vgv_A		384	UDP-N-acetylglucosamine 2-epimerase; structural ge	98.46
2f9f_A		177	First mannosyl transferase (WBAZ-1); alpha-beta pr	98.31
3okp_A		394	GDP-mannose-dependent alpha-(1-6)-phosphatidylino	98.17
2iw1_A		374	Lipopolysaccharide core biosynthesis protein RFAG;	98.17
3beo_A		375	UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a	98.12
2bfw_A		200	GLGA glycogen synthase; glycosyltransferase family	98.07
2gek_A		406	Phosphatidylinositol mannosyltransferase (PIMA); G	98.04
2jjm_A		394	Glycosyl transferase, group 1 family protein; anth	98.01
3qhp_A		166	Type 1 capsular polysaccharide biosynthesis prote	97.95
3c48_A		438	Predicted glycosyltransferases; retaining glycosyl	97.92
2x6q_A		416	Trehalose-synthase TRET; biosynthetic protein; 2.2	97.87
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	97.53
3oy2_A		413	Glycosyltransferase B736L; rossmann fold, GDP-mann	97.5
2xci_A		374	KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci	97.31
2iuy_A		342	Avigt4, glycosyltransferase; antibiotics, family G	97.3
2x0d_A		413	WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge	97.15
3fro_A		439	GLGA glycogen synthase; glycosyltransferase family	97.11
1rzu_A		485	Glycogen synthase 1; glycosyl-transferase, GT-B fo	97.07
2qzs_A		485	Glycogen synthase; glycosyl-transferase, GT-B fold	96.96
2r60_A		499	Glycosyl transferase, group 1; rossmann-fold; 1.80	96.86
3s2u_A		365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape	96.49
2hy7_A		406	Glucuronosyltransferase GUMK; glycosyltransferases	96.49
3vue_A		536	GBSS-I, granule-bound starch synthase 1, chloropla	95.79
3tov_A		349	Glycosyl transferase family 9; structural genomics	95.53
3s28_A		816	Sucrose synthase 1; glycosyltransferase, sucrose m	95.42
2gt1_A		326	Lipopolysaccharide heptosyltransferase-1; GT-B fol	95.21
1hdo_A		206	Biliverdin IX beta reductase; foetal metabolism, H	95.07
1g63_A		181	Epidermin modifying enzyme EPID; alpha, beta prote	94.86
3q3e_A		631	HMW1C-like glycosyltransferase; N-glycosylation; 2	94.85
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	94.76
3e8x_A		236	Putative NAD-dependent epimerase/dehydratase; stru	94.73
3sbx_A		189	Putative uncharacterized protein; structural genom	94.61
3qua_A		199	Putative uncharacterized protein; structural genom	94.51
2bka_A		242	CC3, TAT-interacting protein TIP30; NADPH, PEG600,	93.89
3dqp_A		219	Oxidoreductase YLBE; alpha-beta protein., structur	93.67
3rhz_A		339	GTF3, nucleotide sugar synthetase-like protein; gl	93.59
3slg_A		372	PBGP3 protein; structural genomics, seattle struct	93.26
3dhn_A		227	NAD-dependent epimerase/dehydratase; reductase, PF	93.17
3qvo_A		236	NMRA family protein; structural genomics, PSI-biol	93.08
3e48_A		289	Putative nucleoside-diphosphate-sugar epimerase; a	92.79
3oid_A		258	Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa	92.19
3rft_A		267	Uronate dehydrogenase; apoenzyme, rossmann fold, N	91.92
3ew7_A		221	LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend	91.56
3zqu_A		209	Probable aromatic acid decarboxylase; lyase; HET:	91.49
3qjg_A		175	Epidermin biosynthesis protein EPID; structural ge	91.36
3nb0_A		725	Glycogen [starch] synthase isoform 2; glycogen syn	91.33
3i6i_A		346	Putative leucoanthocyanidin reductase 1; rossmann	91.32
2x4g_A		342	Nucleoside-diphosphate-sugar epimerase; isomerase;	91.22
1s2d_A		167	Purine trans deoxyribosylase; ribosylate intermedi	91.2
2c5a_A		379	GDP-mannose-3', 5'-epimerase; short chain dehydrat	91.19
1psw_A		348	ADP-heptose LPS heptosyltransferase II; structural	91.14
2gk4_A		232	Conserved hypothetical protein; alpha-beta-alpha s	90.92
2ejb_A		189	Probable aromatic acid decarboxylase; phenylacryli	90.84
2iz6_A		176	Molybdenum cofactor carrier protein; metal transpo	90.51
3ruf_A		351	WBGU; rossmann fold, UDP-hexose 4-epimerase, isome	90.11
2pzm_A		330	Putative nucleotide sugar epimerase/ dehydratase;	90.03
4id9_A		347	Short-chain dehydrogenase/reductase; putative dehy	89.89
3tsa_A		391	SPNG, NDP-rhamnosyltransferase; glycosyltransferas	89.79
3h2s_A		224	Putative NADH-flavin reductase; Q03B84, NESG, LCR1	89.72
3ehd_A		162	Uncharacterized conserved protein; PSI,MCSG,PF0501	89.7
3tpc_A		257	Short chain alcohol dehydrogenase-related dehydro;	89.63
2khz_A		165	C-MYC-responsive protein RCL; flexible loop, nucle	89.48
2bll_A		345	Protein YFBG; decarboxylase, short chain dehydroge	89.33
3r6d_A		221	NAD-dependent epimerase/dehydratase; structural ge	89.31
1yo6_A		250	Putative carbonyl reductase sniffer; tyrosine-depe	89.18
2f62_A		161	Nucleoside 2-deoxyribosyltransferase; SGPP, struct	88.96
3h7a_A		252	Short chain dehydrogenase; oxidoreductase, PSI-2,	88.77
1u7z_A		226	Coenzyme A biosynthesis bifunctional protein coabc	88.74
2o23_A		265	HADH2 protein; HSD17B10, schad, ERAB, type II HADH	88.65
1p3y_1		194	MRSD protein; flavoprotein, FMN, rossmann fold, HF	88.64
2hq1_A		247	Glucose/ribitol dehydrogenase; CTH-1438, structura	88.55
3ezl_A		256	Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA	88.49
3ko8_A		312	NAD-dependent epimerase/dehydratase; isomerase, UD	88.45
1sby_A		254	Alcohol dehydrogenase; ternary complex, NAD, trifl	88.42
4e3z_A		272	Putative oxidoreductase protein; PSI-biology, stru	88.38
3icc_A		255	Putative 3-oxoacyl-(acyl carrier protein) reducta;	88.32
3ehe_A		313	UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC,	88.24
3sxp_A		362	ADP-L-glycero-D-mannoheptose-6-epimerase; rossman	88.09
2gn4_A		344	FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann	88.0
2i2c_A		272	Probable inorganic polyphosphate/ATP-NAD kinase 1;	87.97
1oc2_A		348	DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos	87.95
2jl1_A		287	Triphenylmethane reductase; oxidoreductase, biorem	87.94
3un1_A		260	Probable oxidoreductase; structural genomics, PSI-	87.8
1f0k_A		364	MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe	87.78
2wm3_A		299	NMRA-like family domain containing protein 1; unkn	87.75
3rd5_A		291	Mypaa.01249.C; ssgcid, structural genomics, seattl	87.67
3m2p_A		311	UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J	87.66
1f8y_A		157	Nucleoside 2-deoxyribosyltransferase; active site,	87.52
1yt5_A		258	Inorganic polyphosphate/ATP-NAD kinase; domain 1:	87.51
1xq6_A		253	Unknown protein; structural genomics, protein stru	87.49
4iiu_A		267	3-oxoacyl-[acyl-carrier protein] reductase; struct	87.41
3ia7_A		402	CALG4; glycosysltransferase, calicheamicin, enediy	87.22
3edm_A		259	Short chain dehydrogenase; structural genomics, ox	87.22
4fyk_A		152	Deoxyribonucleoside 5'-monophosphate N-glycosidas;	87.07
1qyc_A		308	Phenylcoumaran benzylic ether reductase PT1; NADPH	87.06
2an1_A		292	Putative kinase; structural genomics, PSI, protein	87.04
4f3y_A		272	DHPR, dihydrodipicolinate reductase; structural ge	86.76
3m1a_A		281	Putative dehydrogenase; short, PSI, MCSG, structur	86.66
3ijp_A		288	DHPR, dihydrodipicolinate reductase; ssgcid, SBRI,	86.6
3p19_A		266	BFPVVD8, putative blue fluorescent protein; rossma	86.57
3gpi_A		286	NAD-dependent epimerase/dehydratase; structural ge	86.44
3afn_B		258	Carbonyl reductase; alpha/beta/alpha, rossmann-fol	86.37
4da9_A		280	Short-chain dehydrogenase/reductase; structural ge	86.26
3otg_A		412	CALG1; calicheamicin, TDP, structural genomics, PS	86.16
2q1w_A		333	Putative nucleotide sugar epimerase/ dehydratase;	86.13
4egb_A		346	DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce	86.11
2hun_A		336	336AA long hypothetical DTDP-glucose 4,6-dehydrat;	86.06
2rh8_A		338	Anthocyanidin reductase; flavonoids, rossmann fold	85.73
2zcu_A		286	Uncharacterized oxidoreductase YTFG; alpha-beta sa	85.68
2q5c_A		196	NTRC family transcriptional regulator; structural	85.49
3v2g_A		271	3-oxoacyl-[acyl-carrier-protein] reductase; struct	85.4
1u0t_A		307	Inorganic polyphosphate/ATP-NAD kinase; alpha-beta	85.35
3u5t_A		267	3-oxoacyl-[acyl-carrier-protein] reductase; struct	85.32
3h4t_A		404	Glycosyltransferase GTFA, glycosyltransferase; van	85.27
4fzr_A		398	SSFS6; structural genomics, PSI-biology, protein s	85.06
2q2v_A		255	Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore	85.05
1rkx_A		357	CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD;	85.04
3is3_A		270	17BETA-hydroxysteroid dehydrogenase; short chain d	85.0
2c20_A		330	UDP-glucose 4-epimerase; carbohydrate metabolism,	84.92
1p9o_A		313	Phosphopantothenoylcysteine synthetase; ligase; 2.	84.64
1w6u_A		302	2,4-dienoyl-COA reductase, mitochondrial precursor	84.63
4iin_A		271	3-ketoacyl-acyl carrier protein reductase (FABG);	84.62
2dtx_A		264	Glucose 1-dehydrogenase related protein; rossmann	84.6
3r1i_A		276	Short-chain type dehydrogenase/reductase; structur	84.59
1xgk_A		352	Nitrogen metabolite repression regulator NMRA; ros	84.53
3orf_A		251	Dihydropteridine reductase; alpha-beta-alpha sandw	84.39
2z1m_A		345	GDP-D-mannose dehydratase; short-chain dehydrogena	84.3
1ff9_A		450	Saccharopine reductase; lysine biosynthesis, alpha	84.26
1o5i_A		249	3-oxoacyl-(acyl carrier protein) reductase; TM1169	84.21
2pk3_A		321	GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor	84.18
3oti_A		398	CALG3; calicheamicin, TDP, structural genomics, PS	84.13
3osu_A		246	3-oxoacyl-[acyl-carrier-protein] reductase; struct	84.04
1qyd_A		313	Pinoresinol-lariciresinol reductase; NADPH-depende	83.97
3qiv_A		253	Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR	83.82
3vtz_A		269	Glucose 1-dehydrogenase; rossmann fold, oxidoreduc	83.81
3sju_A		279	Keto reductase; short-chain dehydrogenase, oxidore	83.62
2v6g_A		364	Progesterone 5-beta-reductase; tyrosine-dependent	83.6
3lyl_A		247	3-oxoacyl-(acyl-carrier-protein) reductase; alpha	83.59
3enk_A		341	UDP-glucose 4-epimerase; seattle structural genomi	83.57
3ijr_A		291	Oxidoreductase, short chain dehydrogenase/reducta;	83.56
3tl3_A		257	Short-chain type dehydrogenase/reductase; ssgcid,	83.53
3bq9_A		460	Predicted rossmann fold nucleotide-binding domain	83.52
3imf_A		257	Short chain dehydrogenase; structural genomics, in	83.41
3rih_A		293	Short chain dehydrogenase or reductase; structural	83.34
2nm0_A		253	Probable 3-oxacyl-(acyl-carrier-protein) reductas;	83.31
4dmm_A		269	3-oxoacyl-[acyl-carrier-protein] reductase; rossma	83.27
2q1s_A		377	Putative nucleotide sugar epimerase/ dehydratase;	83.23
2pd6_A		264	Estradiol 17-beta-dehydrogenase 8; short-chain deh	83.18
1sb8_A		352	WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN	83.03
3sc4_A		285	Short chain dehydrogenase (A0QTM2 homolog); ssgcid	83.02
3uf0_A		273	Short-chain dehydrogenase/reductase SDR; gluconate	83.02
3ucx_A		264	Short chain dehydrogenase; ssgcid, seattle structu	83.01
4imr_A		275	3-oxoacyl-(acyl-carrier-protein) reductase; oxidor	82.97
2fwm_X		250	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e	82.92
3ctm_A		279	Carbonyl reductase; alcohol dehydrogenase, short-c	82.84
1z7e_A		660	Protein aRNA; rossmann fold, OB-like fold, hydrola	82.79
3awd_A		260	GOX2181, putative polyol dehydrogenase; oxidoreduc	82.74
2hrz_A		342	AGR_C_4963P, nucleoside-diphosphate-sugar epimeras	82.72
3l7i_A		729	Teichoic acid biosynthesis protein F; GT-B fold, m	82.65
3rkr_A		262	Short chain oxidoreductase; rossmann fold; HET: NA	82.61
3gk3_A		269	Acetoacetyl-COA reductase; acetoacetyl-CO reductas	82.44
2a4k_A		263	3-oxoacyl-[acyl carrier protein] reductase; reduct	82.23
2pju_A		225	Propionate catabolism operon regulatory protein; s	82.2
2z5l_A		511	Tylkr1, tylactone synthase starter module and modu	82.14
4b4o_A		298	Epimerase family protein SDR39U1; isomerase; HET:	82.05
1hdc_A		254	3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi	81.97
1ooe_A		236	Dihydropteridine reductase; structural genomics, P	81.93
3i4f_A		264	3-oxoacyl-[acyl-carrier protein] reductase; struct	81.91
3ai3_A		263	NADPH-sorbose reductase; rossmann-fold, NADPH-depe	81.87
3ox4_A		383	Alcohol dehydrogenase 2; iron, NAD, oxidoreductase	81.85
3u9l_A		324	3-oxoacyl-[acyl-carrier-protein] reductase; struct	81.76
1sny_A		267	Sniffer CG10964-PA; alpha and beta protein, rossma	81.51
1nff_A		260	Putative oxidoreductase RV2002; directed evolution	81.31
3rsc_A		415	CALG2; TDP, enediyne, structural genomics, PSI-2,	81.28
4e6p_A		259	Probable sorbitol dehydrogenase (L-iditol 2-dehyd;	81.18
3tzq_B		271	Short-chain type dehydrogenase/reductase; ssgcid,	81.17
1e6u_A		321	GDP-fucose synthetase; epimerase/reductase, SDR, R	81.16
3dii_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	81.08
1uzm_A		247	3-oxoacyl-[acyl-carrier protein] reductase; beta-k	81.01
3gdg_A		267	Probable NADP-dependent mannitol dehydrogenase; ro	80.94
1fmc_A		255	7 alpha-hydroxysteroid dehydrogenase; short-chain	80.93
3gaf_A		256	7-alpha-hydroxysteroid dehydrogenase; seattle stru	80.89
2b69_A		343	UDP-glucuronate decarboxylase 1; UDP-glucoronic ac	80.75
3afo_A		388	NADH kinase POS5; alpha/beta+BETA sandwich, ATP-bi	80.74
3nrc_A		280	Enoyl-[acyl-carrier-protein] reductase (NADH); ros	80.73
2fr1_A		486	Erythromycin synthase, eryai; short chain dehydrog	80.67
3tjr_A		301	Short chain dehydrogenase; structural genomics, se	80.64
1edo_A		244	Beta-keto acyl carrier protein reductase; nucleoti	80.45
3ak4_A		263	NADH-dependent quinuclidinone reductase; SDR, (R)-	80.39
3tfo_A		264	Putative 3-oxoacyl-(acyl-carrier-protein) reducta;	80.27
2r6j_A		318	Eugenol synthase 1; phenylpropene, PIP reductase,	80.2
3zv4_A		281	CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox	80.13
3ksu_A		262	3-oxoacyl-acyl carrier protein reductase; structur	80.06

>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A	Back alignment and structure

Probab=99.96  E-value=1.6e-29  Score=181.83  Aligned_cols=127  Identities=41%  Similarity=0.608  Sum_probs=105.6

Q ss_pred             CCceEEEEeCCcc-HHHHHHHhhhHHHHHHHHhcCCceEEEEeeCCCCCc--c----c----------------------
Q psy14775          2 ALSQVFVTVGTTK-FDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKP--N----I----------------------   52 (129)
Q Consensus         2 ~~~~vlVt~Gs~~-~~~l~~~v~~~~~~~~l~~~~~~~vvv~~G~~~~~~--~----~----------------------   52 (129)
                      .+|+||||+||+. +++++..+...++++.|.+.+..++++|||++..+.  .    +                      
T Consensus        27 ~~~~VlVtgGS~~~~n~li~~vl~~~~l~~L~~~~~~~vv~q~G~~~~~~~~~~~~~~~~~~~~~l~p~~~~~~~~~~~~  106 (224)
T 2jzc_A           27 EEKALFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERGGQRESQKIPIDQFGCGDTARQ  106 (224)
T ss_dssp             CSCCEEEECCSCCSCHHHHHHHTSHHHHHHHHTTTCCCEEECCCSSSCCCCCSHHHHHTCEECSCCCSSCTTCTTCSCEE
T ss_pred             CCCEEEEEcCCchHHHHHHHHHHHHHHHHHHhcCCCeEEEEEECCCchhhHHHHHHhhhccccccccccccccccccccc
Confidence            4689999999995 788888776555667777666335999999887511  0    1                      


Q ss_pred             ---ccCCceEEEeeCccCHHHHhh-hCcEEEecCChHHHHHHHHhCCcEEEEeCCCCCChhHHHHHHHHHHCCcEEEecC
Q psy14775         53 ---TESGLTVHSYDYKSSISEDIE-SSDLVIAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVP  128 (129)
Q Consensus        53 ---~~~~~~v~~~~~~~~m~~~l~-~adlvIs~aG~~Ti~e~l~~g~P~i~vP~~~~~~~~Q~~nA~~l~~~G~~~~~~~  128 (129)
                         .....++++++|+++|.++|+ +||+||||||+||++|++++|+|+|+||++.+.+|||.+||+++++.|+++++.+
T Consensus       107 ~~~~~~~~~v~v~~f~~~m~~~l~~~AdlvIshaGagTv~Eal~~G~P~IvVP~~~~~~~HQ~~nA~~l~~~G~~~~~~~  186 (224)
T 2jzc_A          107 YVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAP  186 (224)
T ss_dssp             EESTTTSSEEEECCSSSSHHHHHHHHCSCEEESSCHHHHHHHHHTTCCCCEECCSSCCCCHHHHHHHHHHHHSCCCEECS
T ss_pred             cccccCCceEEEeeccchHHHHHHhcCCEEEECCcHHHHHHHHHhCCCEEEEcCcccccchHHHHHHHHHHCCCEEEcCH
Confidence               011347889999999999999 9999999999999999999999999999987788999999999999999987755

PyMOL of 2jzc

>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A*	Back alignment and structure

>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens}	Back alignment and structure

>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5	Back alignment and structure

>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A*	Back alignment and structure

>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus}	Back alignment and structure

>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5	Back alignment and structure

>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A*	Back alignment and structure

>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea}	Back alignment and structure

>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora}	Back alignment and structure

>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A*	Back alignment and structure

>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A*	Back alignment and structure

>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A*	Back alignment and structure

>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A*	Back alignment and structure

>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A*	Back alignment and structure

>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus}	Back alignment and structure

>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae}	Back alignment and structure

>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A*	Back alignment and structure

>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10	Back alignment and structure

>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A*	Back alignment and structure

>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A*	Back alignment and structure

>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A*	Back alignment and structure

>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A*	Back alignment and structure

>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes}	Back alignment and structure

>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae}	Back alignment and structure

>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3	Back alignment and structure

>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii}	Back alignment and structure

>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A*	Back alignment and structure

>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8	Back alignment and structure

>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A*	Back alignment and structure

>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A*	Back alignment and structure

>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A	Back alignment and structure

>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8	Back alignment and structure

>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A*	Back alignment and structure

>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A*	Back alignment and structure

>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori}	Back alignment and structure

>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A*	Back alignment and structure

>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A*	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A*	Back alignment and structure

>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A*	Back alignment and structure

>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A*	Back alignment and structure

>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A*	Back alignment and structure

>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A*	Back alignment and structure

>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A	Back alignment and structure

>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A	Back alignment and structure

>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A*	Back alignment and structure

>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A*	Back alignment and structure

>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A*	Back alignment and structure

>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula}	Back alignment and structure

>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A*	Back alignment and structure

>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A*	Back alignment and structure

>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*	Back alignment and structure

>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A*	Back alignment and structure

>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}	Back alignment and structure

>3sbx_A Putative uncharacterized protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: AMP; 2.50A {Mycobacterium marinum M}	Back alignment and structure

>3qua_A Putative uncharacterized protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium smegmatis str}	Back alignment and structure

>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A	Back alignment and structure

>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp}	Back alignment and structure

>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A*	Back alignment and structure

>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei}	Back alignment and structure

>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A}	Back alignment and structure

>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp}	Back alignment and structure

>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A*	Back alignment and structure

>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A*	Back alignment and structure

>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes}	Back alignment and structure

>3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0	Back alignment and structure

>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0	Back alignment and structure

>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A*	Back alignment and structure

>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A*	Back alignment and structure

>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa}	Back alignment and structure

>1s2d_A Purine trans deoxyribosylase; ribosylate intermediate, PTD, ARAA, transferase; HET: AR4 ADE; 2.10A {Lactobacillus helveticus} SCOP: c.23.14.1 PDB: 1s2g_A* 1s2i_A* 1s2l_A 1s3f_A*	Back alignment and structure

>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A*	Back alignment and structure

>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7	Back alignment and structure

>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae}	Back alignment and structure

>2ejb_A Probable aromatic acid decarboxylase; phenylacrylic acid decarboxylase, X-RAY diffraction, structural genomics, NPPSFA; 2.15A {Aquifex aeolicus}	Back alignment and structure

>2iz6_A Molybdenum cofactor carrier protein; metal transport; 1.60A {Chlamydomonas reinhardtii} PDB: 2iz5_A 2iz7_A	Back alignment and structure

>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A*	Back alignment and structure

>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A*	Back alignment and structure

>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A*	Back alignment and structure

>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A*	Back alignment and structure

>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334}	Back alignment and structure

>3ehd_A Uncharacterized conserved protein; PSI,MCSG,PF05014, structural genomics, protein structure INI midwest center for structural genomics; HET: MSE; 2.15A {Enterococcus faecalis}	Back alignment and structure

>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti}	Back alignment and structure

>2khz_A C-MYC-responsive protein RCL; flexible loop, nucleus, phosphoprotein, nuclear protein; NMR {Rattus norvegicus} PDB: 2klh_A*	Back alignment and structure

>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A	Back alignment and structure

>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A*	Back alignment and structure

>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2f62_A Nucleoside 2-deoxyribosyltransferase; SGPP, structural genomics, PSI, S genomics of pathogenic protozoa consortium; HET: 12M; 1.50A {Trypanosoma brucei} SCOP: c.23.14.1 PDB: 2a0k_A* 2f2t_A* 2f64_A* 2f67_A*	Back alignment and structure

>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris}	Back alignment and structure

>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A*	Back alignment and structure

>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A*	Back alignment and structure

>1p3y_1 MRSD protein; flavoprotein, FMN, rossmann fold, HFCD family, oxdidative decarboxylation, cystein, lantibiotics, mersacidin, oxidore; HET: FAD; 2.54A {Bacillus SP} SCOP: c.34.1.1	Back alignment and structure

>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum}	Back alignment and structure

>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A*	Back alignment and structure

>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A*	Back alignment and structure

>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli}	Back alignment and structure

>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str}	Back alignment and structure

>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0	Back alignment and structure

>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori}	Back alignment and structure

>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A*	Back alignment and structure

>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A*	Back alignment and structure

>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A*	Back alignment and structure

>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D	Back alignment and structure

>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti}	Back alignment and structure

>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A*	Back alignment and structure

>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A	Back alignment and structure

>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis}	Back alignment and structure

>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus}	Back alignment and structure

>1f8y_A Nucleoside 2-deoxyribosyltransferase; active site, alpha/beta protein, biocatalyst, X- RAY crystallography; HET: 5MD; 2.40A {Lactobacillus leichmannii} SCOP: c.23.14.1 PDB: 1f8x_A*	Back alignment and structure

>1yt5_A Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima}	Back alignment and structure

>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A*	Back alignment and structure

>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A*	Back alignment and structure

>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora}	Back alignment and structure

>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str}	Back alignment and structure

>4fyk_A Deoxyribonucleoside 5'-monophosphate N-glycosidas; hydrolas; HET: SRA; 1.79A {Rattus norvegicus} PDB: 4fyh_A* 4fyi_A* 2klh_A*	Back alignment and structure

>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2	Back alignment and structure

>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium}	Back alignment and structure

>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis}	Back alignment and structure

>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis}	Back alignment and structure

>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae}	Back alignment and structure

>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus}	Back alignment and structure

>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT}	Back alignment and structure

>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A*	Back alignment and structure

>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A*	Back alignment and structure

>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica}	Back alignment and structure

>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis}	Back alignment and structure

>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A	Back alignment and structure

>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A*	Back alignment and structure

>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824}	Back alignment and structure

>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti}	Back alignment and structure

>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A	Back alignment and structure

>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti}	Back alignment and structure

>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A*	Back alignment and structure

>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A*	Back alignment and structure

>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A	Back alignment and structure

>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A*	Back alignment and structure

>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A	Back alignment and structure

>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis}	Back alignment and structure

>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1	Back alignment and structure

>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A*	Back alignment and structure

>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A	Back alignment and structure

>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A	Back alignment and structure

>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum}	Back alignment and structure

>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A*	Back alignment and structure

>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum}	Back alignment and structure

>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A*	Back alignment and structure

>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A	Back alignment and structure

>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus}	Back alignment and structure

>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A*	Back alignment and structure

>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A*	Back alignment and structure

>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2	Back alignment and structure

>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp}	Back alignment and structure

>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium}	Back alignment and structure

>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber}	Back alignment and structure

>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A*	Back alignment and structure

>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2	Back alignment and structure

>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A*	Back alignment and structure

>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans}	Back alignment and structure

>3bq9_A Predicted rossmann fold nucleotide-binding domain containing protein; structural genomics, PSI-2, protein structure initiative; 1.80A {Idiomarina baltica}	Back alignment and structure

>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str}	Back alignment and structure

>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus}	Back alignment and structure

>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor}	Back alignment and structure

>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A*	Back alignment and structure

>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A*	Back alignment and structure

>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens}	Back alignment and structure

>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A*	Back alignment and structure

>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile}	Back alignment and structure

>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0	Back alignment and structure

>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum}	Back alignment and structure

>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli}	Back alignment and structure

>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis}	Back alignment and structure

>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1	Back alignment and structure

>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans}	Back alignment and structure

>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens}	Back alignment and structure

>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A*	Back alignment and structure

>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5}	Back alignment and structure

>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}	Back alignment and structure

>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1	Back alignment and structure

>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae}	Back alignment and structure

>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens}	Back alignment and structure

>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A*	Back alignment and structure

>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0	Back alignment and structure

>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A*	Back alignment and structure

>3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A*	Back alignment and structure

>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti}	Back alignment and structure

>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2	Back alignment and structure

>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A*	Back alignment and structure

>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A*	Back alignment and structure

>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A	Back alignment and structure

>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0	Back alignment and structure

>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A*	Back alignment and structure

>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A	Back alignment and structure

>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A	Back alignment and structure

>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A*	Back alignment and structure

>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis}	Back alignment and structure

>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A*	Back alignment and structure

>3afo_A NADH kinase POS5; alpha/beta+BETA sandwich, ATP-binding, mitochondrion NADP, nucleotide-binding, transferase, transit peptide; HET: NAI; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A*	Back alignment and structure

>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A*	Back alignment and structure

>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp}	Back alignment and structure

>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G	Back alignment and structure

>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens}	Back alignment and structure

>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti}	Back alignment and structure

>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A*	Back alignment and structure

>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A*	Back alignment and structure

>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		129
d1f0ka_		351	Peptidoglycan biosynthesis glycosyltransferase Mur	99.88
d1rrva_		401	TDP-vancosaminyltransferase GftD {Amycolatopsis or	99.78
d1iira_		401	UDP-glucosyltransferase GtfB {Amycolatopsis orient	99.76
d1pn3a_		391	TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi	99.74
d2c1xa1		450	UDP glucose:flavonoid 3-o-glucosyltransferase {Gra	99.65
d2pq6a1		473	(Iso)flavonoid glycosyltransferase {Medicago trunc	99.63
d2acva1		461	Triterpene UDP-glucosyl transferase UGT71G1 {Medic	99.53
d2vcha1		471	Hydroquinone glucosyltransferase {Thale cress (Ara	99.52
d2iw1a1		370	Lipopolysaccharide core biosynthesis protein RfaG	97.91
d2f9fa1		166	First mannosyl transferase WbaZ {Archaeoglobus ful	97.62
d2bfwa1		196	Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI	97.1
d1rzua_		477	Glycogen synthase 1, GlgA {Agrobacterium tumefacie	96.5
d2bisa1		437	Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI	96.41
d1hdoa_		205	Biliverdin IX beta reductase {Human (Homo sapiens)	96.39
d2bkaa1		232	TAT-interacting protein TIP30 {Human (Homo sapiens	96.27
d1rcua_		170	Hypothetical protein TM1055 {Thermotoga maritima [	94.88
d1yo6a1		250	Putative carbonyl reductase sniffer {Caenorhabditi	94.83
d1t35a_		179	Hypothetical protein YvdD {Bacillus subtilis [TaxI	94.41
d1g5qa_		174	Epidermin modifying enzyme (peptidyl-cysteine deca	94.39
d2b69a1		312	UDP-glucuronate decarboxylase 1 {Human (Homo sapie	94.01
d1v4va_		373	UDP-N-acetylglucosamine 2-epimerase {Thermus therm	93.87
d1weka_		208	Hypothetical protein TT1465 (TTHA1644) {Thermus th	93.77
d1o6ca_		377	UDP-N-acetylglucosamine 2-epimerase {Bacillus subt	93.53
d1f8ya_		156	Nucleoside 2-deoxyribosyltransferase {Lactobacillu	92.62
d1pswa_		348	ADP-heptose LPS heptosyltransferase II {Escherichi	92.58
d1s2da_		167	Purine transdeoxyribosylase {Lactobacillus helveti	92.57
d2q46a1		252	Hypothetical protein At5g02240 (T7H20_290) {Thale	92.43
d2f62a1		152	Nucleoside 2-deoxyribosyltransferase {Trypanosoma	92.22
d1luaa1		191	Methylene-tetrahydromethanopterin dehydrogenase {M	92.13
d2c5aa1		363	GDP-mannose-3', 5'-epimerase {Thale cress (Arabido	89.81
d1u7za_		223	Coenzyme A biosynthesis bifunctional protein CoaBC	89.39
d1sbya1		254	Drosophila alcohol dehydrogenase {Fly (Drosophila	89.2
d2q4oa1		183	Hypothetical protein At2g37210/T2N18.3 {Thale cres	88.99
d1gpja2		159	Glutamyl tRNA-reductase middle domain {Archaeon Me	88.64
d1qyca_		307	Phenylcoumaran benzylic ether reductase {Loblolly	88.25
d1qyda_		312	Pinoresinol-lariciresinol reductase {Giant arborvi	88.2
d2blla1		342	Polymyxin resistance protein ArnA (PrmI) {Escheric	88.04
d2a35a1		212	Hypothetical protein PA4017 {Pseudomonas aeruginos	87.04
d1n7ha_		339	GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop	86.27
d1p3y1_		183	MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]}	86.2
d1u0ta_		302	Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycob	86.15
d1o5ia_		234	beta-keto acyl carrier protein reductase {Thermoto	85.23
d1udca_		338	Uridine diphosphogalactose-4-epimerase (UDP-galact	85.04
d1ydhb_		181	Hypothetical protein At5g11950 {Thale cress (Arabi	84.97
d1f6da_		376	UDP-N-acetylglucosamine 2-epimerase {Escherichia c	83.91
d1weha_		171	Hypothetical protein TT1887 (TTHA0294) {Thermus th	83.08
d1xgka_		350	Negative transcriptional regulator NmrA {Aspergill	82.64

>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Peptidoglycan biosynthesis glycosyltransferase MurG
domain: Peptidoglycan biosynthesis glycosyltransferase MurG
species: Escherichia coli [TaxId: 562]

Probab=99.88  E-value=1.6e-22  Score=148.18  Aligned_cols=121  Identities=18%  Similarity=0.154  Sum_probs=89.1

Q ss_pred             CceEEEEeCCccHHHHHHHhhhHHHHHHHHhcCCceEEEEeeCCCCCc----ccccCCceEEEeeCccCHHHHhhhCcEE
Q psy14775          3 LSQVFVTVGTTKFDELIDKIQSKEILKILKSKGCKKLIIQHGNGDIKP----NITESGLTVHSYDYKSSISEDIESSDLV   78 (129)
Q Consensus         3 ~~~vlVt~Gs~~~~~l~~~v~~~~~~~~l~~~~~~~vvv~~G~~~~~~----~~~~~~~~v~~~~~~~~m~~~l~~adlv   78 (129)
                      +..+++++||.|...+.+.+.+  .+..+..  ....+++++......    .......++.+++|+++|.++|+.||++
T Consensus       177 ~~~i~~~~gs~g~~~~~~~~~~--~~~~l~~--~~~~i~~~~~~~~~~~~~~~~~~~~~~~~v~~f~~~~~~lm~~adl~  252 (351)
T d1f0ka_         177 PVRVLVVGGSQGARILNQTMPQ--VAAKLGD--SVTIWHQSGKGSQQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVV  252 (351)
T ss_dssp             SEEEEEECTTTCCHHHHHHHHH--HHHHHGG--GEEEEEECCTTCHHHHHHHHHHTTCTTSEEESCCSCHHHHHHHCSEE
T ss_pred             CcccccccccchhhhhHHHHHH--hhhhhcc--cceeeeeccccchhhhhhhhcccccccceeeeehhhHHHHHHhCchh
Confidence            3467788888876666565542  2333332  223444444443211    1122334788899999999999999999


Q ss_pred             EecCChHHHHHHHHhCCcEEEEeCCCCCChhHHHHHHHHHHCCcEEEecC
Q psy14775         79 IAHAGAGTSLEVLEAGKLLITVVNQSLMDNHQLELAQKFHELGYSLYCVP  128 (129)
Q Consensus        79 Is~aG~~Ti~e~l~~g~P~i~vP~~~~~~~~Q~~nA~~l~~~G~~~~~~~  128 (129)
                      |||||++|++|++++|+|+|++|.+ +.++||..||+++++.|+++++..
T Consensus       253 It~~G~~T~~Eal~~g~P~I~iP~~-~~~~~Q~~NA~~l~~~G~~~~~~~  301 (351)
T d1f0ka_         253 VCRSGALTVSEIAAAGLPALFVPFQ-HKDRQQYWNALPLEKAGAAKIIEQ  301 (351)
T ss_dssp             EECCCHHHHHHHHHHTCCEEECCCC-CTTCHHHHHHHHHHHTTSEEECCG
T ss_pred             hccccchHHHHHHHhCCceeeeecc-cCCchHHHHHHHHHHCCCEEEech
Confidence            9999999999999999999999976 357899999999999999998753

PyMOL of d1f0ka_

>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]}	Back information, alignment and structure

>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]}	Back information, alignment and structure

>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]}	Back information, alignment and structure

>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rcua_ c.129.1.1 (A:) Hypothetical protein TM1055 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1t35a_ c.129.1.1 (A:) Hypothetical protein YvdD {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1g5qa_ c.34.1.1 (A:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis [TaxId: 1282]}	Back information, alignment and structure

>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1weka_ c.129.1.1 (A:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1f8ya_ c.23.14.1 (A:) Nucleoside 2-deoxyribosyltransferase {Lactobacillus leichmannii [TaxId: 28039]}	Back information, alignment and structure

>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1s2da_ c.23.14.1 (A:) Purine transdeoxyribosylase {Lactobacillus helveticus [TaxId: 1587]}	Back information, alignment and structure

>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2f62a1 c.23.14.1 (A:9-160) Nucleoside 2-deoxyribosyltransferase {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}	Back information, alignment and structure

>d2q4oa1 c.129.1.1 (A:8-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]}	Back information, alignment and structure

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]}	Back information, alignment and structure

>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]}	Back information, alignment and structure

>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]}	Back information, alignment and structure

>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ydhb_ c.129.1.1 (B:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1weha_ c.129.1.1 (A:) Hypothetical protein TT1887 (TTHA0294) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]}	Back information, alignment and structure