Diaphorina citri psyllid: psy14787


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MHLFHVECVDQWLSSNKRCPICRVDIETHLNKDLLQPTWRLPCMHLFHVECVDQWLSSNKRCPICRVDIETHLNKDLLQPT
cccccEEEcccccccccccccccccccccccccccccCEEccccccccHHHHHHHHccccccccccccccccccccccccc
*HLFHVECVDQWLSSNKRCPICRVDIETHLNKDLLQPTWRLPCMHLFHVECVDQWLSSNKRCPICRVDIET**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLFHVECVDQWLSSNKRCPICRVDIETHLNKDLLQPTWRLPCMHLFHVECVDQWLSSNKRCPICRVDIETHLNKDLLQPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase Arkadia Acts in the NODAL pathway of mesoderm patterning during embryonic development. Acts downstream AXIN1 as an E3 ubiquitin-protein ligase which promotes the ubiquitination of inhibitory SMADs such as SMAD7, induces their proteasomal degradation and thereby enhances the transcriptional activity of TGF-beta and BMP. Activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.confidentQ5R476
E3 ubiquitin-protein ligase Arkadia Acts in the Nodal pathway of mesoderm patterning during embryonic development. Acts downstream AXIN1 as an E3 ubiquitin-protein ligase which promotes the ubiquitination of inhibitory SMADs such as SMAD7, induces their proteasomal degradation and thereby enhances the transcriptional activity of TGF-beta and BMP. Activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.confidentQ99ML9
RING finger protein 165 confidentQ6ZSG1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032184 [MF]SUMO polymer bindingprobableGO:0003674, GO:0032182, GO:0032183, GO:0005515, GO:0005488
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0031145 [BP]anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0051865 [BP]protein autoubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0090302 [MF]mitotic anaphase-promoting complex activityprobableGO:0019787, GO:0016879, GO:0004842, GO:0016881, GO:0003824, GO:0003674, GO:0016874

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KIZ, chain A
Confidence level:very confident
Coverage over the Query: 14-74
View the alignment between query and template
View the model in PyMOL
Template: 4AP4, chain A
Confidence level:very confident
Coverage over the Query: 2-76
View the alignment between query and template
View the model in PyMOL