Diaphorina citri psyllid: psy14809


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MLRRNIDVSMGLVNGSIVYDLECVTTKFEVLPRAYVHREQFSLCLEYAITIHKCQGLSMNNALMDIGSSVFSCGQAYVALSSQNTYWRTF
cEEEcccccccEEccEEEEEcccEEEEEEEccccEEEEEEccccEEEEEEEEccccccccEEEEEccccccccccEEEEEEEEccccccc
MLRRNIDVSMGLVNGSIVYDLECVTTKFEVLPRAYVHREQFSLCLEYAITIHKCQGLSMNNALMDIGSSVFSCGQAYVALSSQNTYWRTF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRRNIDVSMGLVNGSIVYDLECVTTKFEVLPRAYVHREQFSLCLEYAITIHKCQGLSMNNALMDIGSSVFSCGQAYVALSSQNTYWRTF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043141 [MF]ATP-dependent 5'-3' DNA helicase activityprobableGO:0008094, GO:0016818, GO:0008026, GO:0042623, GO:0004003, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0043139, GO:0016462, GO:0003824
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E1S, chain A
Confidence level:confident
Coverage over the Query: 1-89
View the alignment between query and template
View the model in PyMOL