Diaphorina citri psyllid: psy1480

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------

MKLDNPCLSAMRNFRRLIKYSKDENRVKFDPILPLELKNRVSGKGGDSKKAGCIQEMSMAFSCLKANDFVQTNCAKEIKDFIACADLRRSNKYIKKQEFHKKEISIGDKDLKAWEIDALLKKYPRL

cccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccc

*******LSAMRNFRRLIKYSKDENRVKFDPILPLEL*************AGCIQEMSMAFSCLKANDFVQTNCAKEIKDFIACADLRRSNKYIKKQE**K*E****DKDLKAWEIDALLKKYPR*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKLDNPCLSAMRNFRRLIKYSKDENRVKFDPILPLELKNRVSGKGGDSKKAGCIQEMSMAFSCLKANDFVQTNCAKEIKDFIACADLRRSNKYIKKQEFHKKEISIGDKDLKAWEIDALLKKYPRL

Annotation	Function Description	Confidence Level	Reference Protein
Coiled-coil-helix-coiled-coil-helix domain-containing protein 1		confident	Q9CQA6

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488

No EC number assigned to the protein, probably not an enzyme!

Template: 2LQT, chain A
Confidence level:probable
Coverage over the Query: 51-107
View the alignment between query and template
View the model in PyMOL