Diaphorina citri psyllid: psy14815

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48

MINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWVMVIREPYEKLHGLPVETSLRQLVEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPEPQKTNLTLHDVVRRLEAMAPLSLAEPWDNVGLLIEPHNTTKHIKNIMLTIDLTDEVLKEAVENGTDLIIAYHPPIFAPLKRVTNDKWKERVVSTCLAHNIAVYSPHTTWDAIQEGRTKKAPPEVQVPAEW

cCEEcEEccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEEEcccccEEEEEEccccEEEEcccccccEEECcccccccccccEEEEEEcccccEEEEECccccEEEEccccccCEcccccccccccEEEEEEcccccEEEEECccccEEEEEcccccccEEccccccccccEEEEEEcccccEEEEECccccEEEEEccccccccccccccccccccEEEEEEcccccEEEEccccccEEEccccccccccccccccccccEEEEEEEcccccccEEEEEEcccccEEEEcccccEEEEEEccccccccccccccccccccccccccEEEEEEccccccccccccccccEEEEEEEcccccccccccccCEEEccccccCEEEEcccEEEcccHHHHccccccccEEEECcccccccccccEEcccccEEEEEcccccEEEEccccccccccccccccccccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable cytosolic iron-sulfur protein assembly protein ciao1	Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins.	confident	Q6P0D9
Probable cytosolic iron-sulfur protein assembly protein Ciao1	Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins.	confident	Q7PS24
Probable cytosolic iron-sulfur protein assembly protein CIAO1	Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.	confident	Q99KN2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0071817 [CC]	MMXD complex	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0097361 [CC]	CIA complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0006357 [BP]	regulation of transcription from RNA polymerase II promoter	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0016226 [BP]	iron-sulfur cluster assembly	probable	GO:0022607, GO:0009058, GO:0016043, GO:0031163, GO:0044085, GO:0008150, GO:0008152, GO:0071840
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007059 [BP]	chromosome segregation	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0003700 [MF]	sequence-specific DNA binding transcription factor activity	probable	GO:0003674, GO:0001071

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FM0, chain A
Confidence level:very confident
Coverage over the Query: 2-46,81-354
View the alignment between query and template
View the model in PyMOL

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 3-255,272-354
View the alignment between query and template
View the model in PyMOL

Template: 2FYW, chain A
Confidence level:very confident
Coverage over the Query: 356-476
View the alignment between query and template
View the model in PyMOL