Diaphorina citri psyllid: psy14817

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MIQTGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL
ccccccEEEEECccccEEEEEEccccccccccccccccccEEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccccccccEEEEEEEEcccccccEEEEEEccccccEEEEECccccEEEEEEccccc
****GSRLATCSDDATVKIWKEYKPG**********DSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQTGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable cytosolic iron-sulfur protein assembly protein Ciao1 Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins.confidentQ7PS24
Probable cytosolic iron-sulfur protein assembly protein CIAO1 Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.confidentQ99KN2
Probable cytosolic iron-sulfur protein assembly protein CIAO1 Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.confidentQ5M7T1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0071817 [CC]MMXD complexprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0097361 [CC]CIA complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FM0, chain A
Confidence level:very confident
Coverage over the Query: 1-135
View the alignment between query and template
View the model in PyMOL