Diaphorina citri psyllid: psy14862


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
TARRCKGQVINGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRSQPNSYGSEEASTFDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPPKTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYDNESTRT
cccccccEEEcccccECccccEEHHEEccccEEEECccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccc
******G*VINGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRSQPNSY*******FDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLD***************FNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPPKTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYD******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TARRCKGQVINGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRSQPNSYGSEEASTFDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPPKTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYDNESTRT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008234 [MF]cysteine-type peptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QT4, chain A
Confidence level:very confident
Coverage over the Query: 74-262
View the alignment between query and template
View the model in PyMOL
Template: 3TNX, chain A
Confidence level:very confident
Coverage over the Query: 67-221
View the alignment between query and template
View the model in PyMOL
Template: 1EQK, chain A
Confidence level:probable
Coverage over the Query: 5-55
View the alignment between query and template
View the model in PyMOL