Psyllid ID: psy14862

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
TARRCKGQVINGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRSQPNSYGSEEASTFDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPPKTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYDNESTRT
cccccccEEEcccccEEccccEEHHEEccccEEEEEccccccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccc
cccccccEEEEccEEEccEEEEEEHHHHcccHHEccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHccccccccccccccccccccccccHccccccccHHHcccccccccEccccEcHHHHHHHHHHHHHHHHHHcccccEcHHHcccccccccccccccccccccHHHHcccEEEEEEEEccHHccc
tarrckgqvingkasvrgltfqyeaewasgcvhtylgwhprwtgrvhnlilqrsqpnsygseeastfdleefLDHGNQFKDFVREYErqydsdseiERRFDIFRNNLKTIDYytkheqgtatygvnrfadmtdsefnhglssldWEQIENLKSTFETysfnssnsyglaesinykdkgkvlpkvqdqhlcgscwahSAVACLESAYAIKHNelielskqppkthgrfykggvmnlphmlcskgpyslnHAVLnvgydnestrt
tarrckgqvingkasvrglTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRSQPNSYGSEEASTFDLEEFLDHGNQFKDFVREYErqydsdseierrFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNElielskqppkTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNvgydnestrt
TARRCKGQVINGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRSQPNSYGSEEASTFDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPPKTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYDNESTRT
********VINGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQ**************FDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQ**KTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGY*******
******G**INGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRSQPNSY*************LDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLS**********************NSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPPKTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYD******
********VINGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRS**********STFDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPPKTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYDNESTRT
***RCKGQVINGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRSQPNSYGSEEASTFDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLD***************FNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPPKTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYDN*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TARRCKGQVINGKASVRGLTFQYEAEWASGCVHTYLGWHPRWTGRVHNLILQRSQPNSYGSEEASTFDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPPKTHGRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYDNESTRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query263 2.2.26 [Sep-21-2011]
O23791 351 Fruit bromelain OS=Ananas N/A N/A 0.513 0.384 0.365 1e-19
P80884 345 Ananain OS=Ananas comosus N/A N/A 0.524 0.4 0.359 1e-18
P41715 324 Viral cathepsin OS=Choris N/A N/A 0.577 0.469 0.351 2e-17
Q91GE3 323 Viral cathepsin OS=Epiphy N/A N/A 0.577 0.470 0.341 5e-17
Q8QLK1 337 Viral cathepsin OS=Mamest N/A N/A 0.555 0.433 0.325 8e-17
Q9VN93 614 Putative cysteine protein yes N/A 0.513 0.219 0.377 3e-16
Q8V5U0 367 Viral cathepsin OS=Heliot N/A N/A 0.528 0.378 0.315 4e-16
Q9PYY5 346 Viral cathepsin OS=Xestia N/A N/A 0.528 0.401 0.377 7e-16
Q8B9D5 323 Viral cathepsin OS=Rachip N/A N/A 0.574 0.467 0.339 1e-15
O97397 324 Cathepsin L-like proteina N/A N/A 0.513 0.416 0.368 1e-15
>sp|O23791|BROM1_ANACO Fruit bromelain OS=Ananas comosus PE=1 SV=1 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 85/145 (58%), Gaps = 10/145 (6%)

Query: 78  QFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFN 137
           +F++++ EY R Y  D E  RRF IF+NN+K I+ +    + + T G+N+F DMT SEF 
Sbjct: 36  RFEEWMAEYGRVYKDDDEKMRRFQIFKNNVKHIETFNSRNENSYTLGINQFTDMTKSEFV 95

Query: 138 HGLSSLDWEQIENLKSTFE---TYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCW 194
              + +      +L    E     SF+  N   + +SI+++D G V  +V++Q+ CGSCW
Sbjct: 96  AQYTGV------SLPLNIEREPVVSFDDVNISAVPQSIDWRDYGAV-NEVKNQNPCGSCW 148

Query: 195 AHSAVACLESAYAIKHNELIELSKQ 219
           + +A+A +E  Y IK   L+ LS+Q
Sbjct: 149 SFAAIATVEGIYKIKTGYLVSLSEQ 173

Ananas comosus (taxid: 4615)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 3EC: 3
>sp|P80884|ANAN_ANACO Ananain OS=Ananas comosus GN=AN1 PE=1 SV=2 Back     alignment and function description
>sp|P41715|CATV_NPVCF Viral cathepsin OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=Vcath PE=3 SV=1 Back     alignment and function description
>sp|Q91GE3|CATV_NPVEP Viral cathepsin OS=Epiphyas postvittana nucleopolyhedrovirus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q8QLK1|CATV_NPVMC Viral cathepsin OS=Mamestra configurata nucleopolyhedrovirus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q9VN93|CPR1_DROME Putative cysteine proteinase CG12163 OS=Drosophila melanogaster GN=CG12163 PE=2 SV=2 Back     alignment and function description
>sp|Q8V5U0|CATV_NPVHZ Viral cathepsin OS=Heliothis zea nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q9PYY5|CATV_GVXN Viral cathepsin OS=Xestia c-nigrum granulosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q8B9D5|CATV_NPVR1 Viral cathepsin OS=Rachiplusia ou multiple nucleopolyhedrovirus (strain R1) GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|O97397|CATLL_PHACE Cathepsin L-like proteinase OS=Phaedon cochleariae PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
71993922 477 Protein TAG-196 [Caenorhabditis elegans] 0.536 0.295 0.393 6e-20
308506829 475 CRE-TAG-196 protein [Caenorhabditis rema 0.536 0.296 0.386 3e-19
383863617 884 PREDICTED: uncharacterized protein LOC10 0.657 0.195 0.339 8e-19
339246873 496 viral cathepsin [Trichinella spiralis] g 0.505 0.268 0.354 9e-19
312080834 437 ctsf protein [Loa loa] 0.600 0.361 0.366 1e-18
393906608 472 ctsf protein [Loa loa] 0.600 0.334 0.366 1e-18
341878608 478 hypothetical protein CAEBREN_26318 [Caen 0.536 0.294 0.361 1e-18
341878637 478 hypothetical protein CAEBREN_13324 [Caen 0.536 0.294 0.361 1e-18
46948154 461 cathepsin F-like cysteine proteinase, pa 0.528 0.301 0.394 2e-18
348528696 475 PREDICTED: cathepsin F-like [Oreochromis 0.657 0.364 0.336 2e-18
>gi|71993922|ref|NP_505215.2| Protein TAG-196 [Caenorhabditis elegans] gi|351050011|emb|CCD64084.1| Protein TAG-196 [Caenorhabditis elegans] Back     alignment and taxonomy information
 Score =  103 bits (258), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 85/145 (58%), Gaps = 4/145 (2%)

Query: 77  NQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEF 136
           N F DFV  +E++Y +  E+ +RF +F+ N K I    K+EQGTA YG  +F+DMT  EF
Sbjct: 172 NSFLDFVDRHEKKYTNKREVLKRFRVFKKNAKVIRELQKNEQGTAVYGFTKFSDMTTMEF 231

Query: 137 NHGLSSLDWEQ--IENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCW 194
              +    WEQ      ++ FE +   + N   L ES ++++KG V  +V++Q  CGSCW
Sbjct: 232 KKIMLPYQWEQPVYPMEQANFEKHDV-TINEEDLPESFDWREKGAV-TQVKNQGNCGSCW 289

Query: 195 AHSAVACLESAYAIKHNELIELSKQ 219
           A S    +E A+ I  N+L+ LS+Q
Sbjct: 290 AFSTTGNVEGAWFIAKNKLVSLSEQ 314

Source: Caenorhabditis elegans

Species: Caenorhabditis elegans

Genus: Caenorhabditis

Family: Rhabditidae

Order: Rhabditida

Class: Chromadorea

Phylum: Nematoda

Superkingdom: Eukaryota
>gi|308506829|ref|XP_003115597.1| CRE-TAG-196 protein [Caenorhabditis remanei] gi|308256132|gb|EFP00085.1| CRE-TAG-196 protein [Caenorhabditis remanei] Back     alignment and taxonomy information
>gi|383863617|ref|XP_003707276.1| PREDICTED: uncharacterized protein LOC100880620 [Megachile rotundata] Back     alignment and taxonomy information
>gi|339246873|ref|XP_003375070.1| viral cathepsin [Trichinella spiralis] gi|316971622|gb|EFV55373.1| viral cathepsin [Trichinella spiralis] Back     alignment and taxonomy information
>gi|312080834|ref|XP_003142769.1| ctsf protein [Loa loa] Back     alignment and taxonomy information
>gi|393906608|gb|EFO21301.2| ctsf protein [Loa loa] Back     alignment and taxonomy information
>gi|341878608|gb|EGT34543.1| hypothetical protein CAEBREN_26318 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|341878637|gb|EGT34572.1| hypothetical protein CAEBREN_13324 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|46948154|gb|AAT07059.1| cathepsin F-like cysteine proteinase, partial [Brugia malayi] Back     alignment and taxonomy information
>gi|348528696|ref|XP_003451852.1| PREDICTED: cathepsin F-like [Oreochromis niloticus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
WB|WBGene00007055 477 tag-196 [Caenorhabditis elegan 0.536 0.295 0.393 1.1e-27
FB|FBgn0260462 614 CG12163 [Drosophila melanogast 0.536 0.229 0.374 6.6e-22
UNIPROTKB|E2RR02 460 CTSF "Uncharacterized protein" 0.517 0.295 0.333 6.9e-21
UNIPROTKB|F1RU48 460 CTSF "Uncharacterized protein" 0.574 0.328 0.345 1.2e-20
UNIPROTKB|G1SQF0 333 CTSH "Uncharacterized protein" 0.551 0.435 0.302 7.7e-20
TAIR|locus:2090614 452 AT3G19390 [Arabidopsis thalian 0.711 0.413 0.320 1.8e-19
TAIR|locus:2090629 362 AT3G19400 [Arabidopsis thalian 0.577 0.419 0.335 4.5e-19
TAIR|locus:2029924 355 AT1G29090 [Arabidopsis thalian 0.524 0.388 0.347 7.6e-19
TAIR|locus:2122113 355 XCP1 "xylem cysteine peptidase 0.520 0.385 0.340 1e-18
GENEDB_PFALCIPARUM|PF11_0165 484 PF11_0165 "falcipain 2 precurs 0.551 0.299 0.339 1.5e-18
WB|WBGene00007055 tag-196 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 1.1e-27, Sum P(2) = 1.1e-27
 Identities = 57/145 (39%), Positives = 87/145 (60%)

Query:    77 NQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEF 136
             N F DFV  +E++Y +  E+ +RF +F+ N K I    K+EQGTA YG  +F+DMT  EF
Sbjct:   172 NSFLDFVDRHEKKYTNKREVLKRFRVFKKNAKVIRELQKNEQGTAVYGFTKFSDMTTMEF 231

Query:   137 NHGLSSLDWEQ-IENLK-STFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCW 194
                +    WEQ +  ++ + FE +   + N   L ES ++++KG V  +V++Q  CGSCW
Sbjct:   232 KKIMLPYQWEQPVYPMEQANFEKHDV-TINEEDLPESFDWREKGAVT-QVKNQGNCGSCW 289

Query:   195 AHSAVACLESAYAIKHNELIELSKQ 219
             A S    +E A+ I  N+L+ LS+Q
Sbjct:   290 AFSTTGNVEGAWFIAKNKLVSLSEQ 314
GO:0004869 "cysteine-type endopeptidase inhibitor activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008234 "cysteine-type peptidase activity" evidence=IEA
FB|FBgn0260462 CG12163 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR02 CTSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU48 CTSF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G1SQF0 CTSH "Uncharacterized protein" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
TAIR|locus:2090614 AT3G19390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090629 AT3G19400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2029924 AT1G29090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122113 XCP1 "xylem cysteine peptidase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF11_0165 PF11_0165 "falcipain 2 precursor" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.22LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
PTZ00021 489 PTZ00021, PTZ00021, falcipain-2; Provisional 9e-21
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 5e-19
PTZ00200 448 PTZ00200, PTZ00200, cysteine proteinase; Provision 3e-16
pfam00112 213 pfam00112, Peptidase_C1, Papain family cysteine pr 4e-16
pfam0824658 pfam08246, Inhibitor_I29, Cathepsin propeptide inh 5e-16
smart0084857 smart00848, Inhibitor_I29, Cathepsin propeptide in 3e-15
cd02248 210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 6e-15
PTZ00203 348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 4e-14
cd02619 223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 3e-05
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 0.003
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information 
 Score = 90.6 bits (225), Expect = 9e-21
 Identities = 53/163 (32%), Positives = 80/163 (49%), Gaps = 25/163 (15%)

Query: 73  LDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMT 132
           L++ N F  F++E+ ++Y +  E+++R+  F  NL  I+ +   E      G+NRF D++
Sbjct: 163 LENVNSFYLFIKEHGKKYQTPDEMQQRYLSFVENLAKINAHNNKENVLYKKGMNRFGDLS 222

Query: 133 DSEFNHGLSSLDWEQIENLKST-FETYSFNSSNSYGLAESIN-YKDK------------- 177
             EF         ++   LKS  F++    S       + I  YK K             
Sbjct: 223 FEEFK--------KKYLTLKSFDFKSNGKKSPRVINYDDVIKKYKPKDATFDHAKYDWRL 274

Query: 178 -GKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQ 219
              V P V+DQ  CGSCWA S V  +ES YAI+ NEL+ LS+Q
Sbjct: 275 HNGVTP-VKDQKNCGSCWAFSTVGVVESQYAIRKNELVSLSEQ 316

Length = 489
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 263
KOG1542|consensus372 100.0
PTZ00203 348 cathepsin L protease; Provisional 100.0
PTZ00021489 falcipain-2; Provisional 100.0
PTZ00200448 cysteine proteinase; Provisional 100.0
KOG1543|consensus325 100.0
smart00645174 Pept_C1 Papain family cysteine protease. 99.93
cd02621 243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 99.92
cd02698 239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 99.91
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 99.9
cd02620 236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 99.9
PF00112219 Peptidase_C1: Papain family cysteine protease This 99.86
PTZ00364 548 dipeptidyl-peptidase I precursor; Provisional 99.86
PTZ00049 693 cathepsin C-like protein; Provisional 99.85
cd02619 223 Peptidase_C1 C1 Peptidase family (MEROPS database 99.78
PF0824658 Inhibitor_I29: Cathepsin propeptide inhibitor doma 99.74
KOG1544|consensus 470 99.65
PTZ00462 1004 Serine-repeat antigen protein; Provisional 99.63
smart0084857 Inhibitor_I29 Cathepsin propeptide inhibitor domai 99.6
COG4870 372 Cysteine protease [Posttranslational modification, 99.18
cd00585 437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 98.06
PF0812741 Propeptide_C1: Peptidase family C1 propeptide; Int 95.55
PF03051 438 Peptidase_C1_2: Peptidase C1-like family This fami 93.01
>KOG1542|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.2e-52  Score=375.55  Aligned_cols=180  Identities=37%  Similarity=0.632  Sum_probs=155.6

Q ss_pred             HHHHHHHHHHHhCCccCChHHHHHHHHHHHHHHHHHHHhccCCCCceEEEeccCCCCChHHHhcccCCCchhhhhhcccc
Q psy14862         75 HGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKST  154 (263)
Q Consensus        75 ~~~~F~~f~~~y~K~Y~s~~E~~~R~~iF~~Nl~~I~~~N~~~~~s~~~giN~FsDlT~eEf~~~~~~~~~~~~~~~~~~  154 (263)
                      ..++|..|+.+|+|+|.+.+|..+|+.||++|+..++++++.+.++..+|+|+|||||+|||++++++.+....   +..
T Consensus        67 ~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~---~~~  143 (372)
T KOG1542|consen   67 LEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGS---KLP  143 (372)
T ss_pred             hHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHHHHHhhccccccc---cCc
Confidence            47799999999999999999999999999999999999999987899999999999999999999988765311   011


Q ss_pred             CcccccCCCCCCCCCcccccccCCCCCCcccCCCCCchhHHHHhhhHHHHHHHHHcCcceecCCCCc-------------
Q psy14862        155 FETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPP-------------  221 (263)
Q Consensus       155 ~~~~~~~~~~~~~lP~s~DWR~~g~Vtp~VknQg~CGSCWAFat~~~iEs~~~I~tg~~~~LSeQqL-------------  221 (263)
                      .............+|++||||++|+||| |||||+||||||||+||+||++++|++|++++||||||             
T Consensus       144 ~~~~~~~~~~~~~lP~~fDWR~kgaVTp-VKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~~d~gC~GG  222 (372)
T KOG1542|consen  144 GDAAEAPIEPGESLPESFDWRDKGAVTP-VKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDSCDNGCNGG  222 (372)
T ss_pred             cccccCcCCCCCCCCcccchhccCCccc-cccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhhhcccCcCCcCCCC
Confidence            1111111133567999999999999999 99999999999999999999999999999999999999             


Q ss_pred             -------------------------c---------------------------------------------ccCCCCCCc
Q psy14862        222 -------------------------K---------------------------------------------THGRFYKGG  231 (263)
Q Consensus       222 -------------------------K---------------------------------------------~~f~~Y~~G  231 (263)
                                               |                                             ..||+|++|
T Consensus       223 l~~nA~~~~~~~gGL~~E~dYPY~g~~~~~C~~~~~~~~v~I~~f~~l~~nE~~ia~wLv~~GPi~vgiNa~~mQ~YrgG  302 (372)
T KOG1542|consen  223 LMDNAFKYIKKAGGLEKEKDYPYTGKKGNQCHFDKSKIVVSIKDFSMLSNNEDQIAAWLVTFGPLSVGINAKPMQFYRGG  302 (372)
T ss_pred             ChhHHHHHHHHhCCccccccCCccccCCCccccchhhceEEEeccEecCCCHHHHHHHHHhcCCeEEEEchHHHHHhccc
Confidence                                     0                                             789999999


Q ss_pred             cccCCCCcCCCCCCCCCeEEEEEEEecCC
Q psy14862        232 VMNLPHMLCSKGPYSLNHAVLNVGYDNES  260 (263)
Q Consensus       232 V~~~~~c~~~~~~~~~nHaVliVGYG~~~  260 (263)
                      |+.+..-.|+  +..+||||||||||...
T Consensus       303 V~~P~~~~Cs--~~~~~HaVLlvGyG~~g  329 (372)
T KOG1542|consen  303 VSCPSKYICS--PKLLNHAVLLVGYGSSG  329 (372)
T ss_pred             ccCCCcccCC--ccccCceEEEEeecCCC
Confidence            9999444447  77799999999999875

>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>KOG1543|consensus Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>KOG1544|consensus Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>PF08127 Propeptide_C1: Peptidase family C1 propeptide; InterPro: IPR012599 This domain is found at the N-terminal of cathepsin B and cathepsin B-like peptidases that belong to MEROPS peptidase subfamily C1A Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
1pci_A 322 Procaricain Length = 322 2e-14
3tnx_A 363 Structure Of The Precursor Of A Thermostable Varian 3e-12
3qj3_A 331 Structure Of Digestive Procathepsin L2 Proteinase F 1e-09
2c0y_A 315 The Crystal Structure Of A Cys25ala Mutant Of Human 2e-09
3qt4_A 329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 4e-09
7pck_A 314 Crystal Structure Of Wild Type Human Procathepsin K 1e-08
1cjl_A 312 Crystal Structure Of A Cysteine Protease Proform Le 2e-08
1cs8_A 316 Crystal Structure Of Procathepsin L Length = 316 7e-08
2o6x_A 310 Crystal Structure Of Procathepsin L1 From Fasciola 2e-07
3hwn_A 258 Cathepsin L With Az13010160 Length = 258 2e-07
1ppo_A 216 Determination Of The Structure Of Papaya Protease O 4e-07
1meg_A 216 Crystal Structure Of A Caricain D158e Mutant In Com 4e-07
2bdz_A 214 Mexicain From Jacaratia Mexicana Length = 214 5e-07
1cqd_A 221 The 2.1 Angstrom Structure Of A Cysteine Protease W 1e-06
1o0e_A 208 1.9 Angstrom Crystal Structure Of A Plant Cysteine 2e-06
2pns_A 208 1.9 Angstrom Resolution Crystal Structure Of A Plan 3e-06
1yvb_A 241 The Plasmodium Falciparum Cysteine Protease Falcipa 3e-06
1gec_E 216 Glycyl Endopeptidase-complex With Benzyloxycarbonyl 4e-06
2p7u_A 215 The Crystal Structure Of Rhodesain, The Major Cyste 4e-06
1s4v_A 229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 5e-06
3h7d_A 215 The Crystal Structure Of The Cathepsin K Variant M5 7e-06
3f75_A 224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 7e-06
2fo5_A 262 Crystal Structure Of Recombinant Barley Cysteine En 7e-06
3bpm_A 243 Crystal Structure Of Falcipain-3 With Its Inhibitor 7e-06
2f7d_A 215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 7e-06
3bcn_A 209 Crystal Structure Of A Papain-Like Cysteine Proteas 8e-06
1iwd_A 215 Proposed Amino Acid Sequence And The 1.63 Angstrom 8e-06
1u9v_A 217 Crystal Structure Of The Cysteine Protease Human Ca 1e-05
1fh0_A 221 Crystal Structure Of Human Cathepsin V Complexed Wi 1e-05
1mem_A 215 Crystal Structure Of Cathepsin K Complexed With A P 1e-05
1snk_A 214 Cathepsin K Complexed With Carbamate Derivatized No 1e-05
3ovz_A 213 Cathepsin K In Complex With A Covalent Inhibitor Wi 1e-05
3p5w_A 220 Actinidin From Actinidia Arguta Planch (Sarusashi) 2e-05
1khp_A 212 Monoclinic Form Of Papain/zlfg-dam Covalent Complex 2e-05
3h89_A 220 A Combined Crystallographic And Molecular Dynamics 3e-05
3of8_A 221 Structural Basis For Reversible And Irreversible In 3e-05
2f1g_A 220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 3e-05
3hha_A 220 Crystal Structure Of Cathepsin L In Complex With Az 3e-05
2fq9_A 225 Cathepsin S With Nitrile Inhibitor Length = 225 3e-05
2g6d_A 217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 3e-05
3n3g_A 217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 3e-05
2fye_A 217 Mutant Human Cathepsin S With Irreversible Inhibito 3e-05
3ovx_A 218 Cathepsin S In Complex With A Covalent Inhibitor Wi 3e-05
1icf_A175 Crystal Structure Of Mhc Class Ii Associated P41 Ii 3e-05
1npz_A 217 Crystal Structures Of Cathepsin S Inhibitor Complex 3e-05
3pnr_A 240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 3e-05
8pch_A 220 Crystal Structure Of Porcine Cathepsin H Determined 3e-05
1ms6_A 222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 4e-05
1pip_A 212 Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al 6e-05
3u8e_A 222 Crystal Structure Of Cysteine Protease From Bulbs O 8e-05
1yal_A 218 Carica Papaya Chymopapain At 1.7 Angstroms Resoluti 9e-05
1vsn_A 215 Crystal Structure Of A Potent Small Molecule Inhibi 1e-04
1ppp_A 212 Crystal Structure Of Papain-E64-C Complex. Binding 1e-04
3h6s_A 221 Strucure Of Clitocypin - Cathepsin V Complex Length 2e-04
2b1m_A 246 Crystal Structure Of A Papain-Fold Protein Without 2e-04
3iv2_A 220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 3e-04
2nqd_B 221 Crystal Structure Of Cysteine Protease Inhibitor, C 3e-04
1xkg_A 312 Crystal Structure Of The Major House Dust Mite Alle 3e-04
3p5u_A 220 Actinidin From Actinidia Arguta Planch (Sarusashi) 4e-04
3ima_A 212 Complex Strcuture Of Tarocystatin And Papain Length 4e-04
3kwn_A 219 Cathepsin S In Complex With Thioether Acetamide P3 4e-04
3iej_A 222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 4e-04
3bc3_A 220 Exploring Inhibitor Binding At The S Subsites Of Ca 4e-04
1glo_A 217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 4e-04
3mpe_A 220 Crystal Structure Of Human Cathepsin-S C25s Mutant 5e-04
3kse_A 220 Unreduced Cathepsin L In Complex With Stefin A Leng 5e-04
1mhw_A175 Design Of Non-covalent Inhibitors Of Human Cathepsi 5e-04
1aec_A 218 Crystal Structure Of Actinidin-E-64 Complex+ Length 7e-04
3d6s_A 223 Crystal Structure Of Mite Allergen Der F 1 Length = 9e-04
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure 
Iteration: 1

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 82/144 (56%), Gaps = 11/144 (7%)
Query: 79  FKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEFNH 138
           F  ++  + + Y++  E   RF+IF++NL  ID  T  +  +   G+N FAD+++ EFN 
Sbjct: 22  FNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDE-TNKKNNSYWLGLNEFADLSNDEFNE 80
Query: 139 G-LSSLDWEQIENLKSTFETYS--FNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWA 195
             + SL    IE      ++Y   F + +   L E+++++ KG V P V+ Q  CGSCWA
Sbjct: 81  KYVGSLIDATIE------QSYDEEFINEDIVNLPENVDWRKKGAVTP-VRHQGSCGSCWA 133
Query: 196 HSAVACLESAYAIKHNELIELSKQ 219
            SAVA +E    I+  +L+ELS+Q
Sbjct: 134 FSAVATVEGINKIRTGKLVELSEQ 157
>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 Back     alignment and structure
>pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 Back     alignment and structure
>pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 Back     alignment and structure
>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
1by8_A 314 Protein (procathepsin K); hydrolase(sulfhydryl pro 3e-37
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 8e-04
1pci_A 322 Procaricain; zymogen, hydrolase, thiol protease; 3 1e-36
2c0y_A 315 Procathepsin S; proenzyme, proteinase, hydrolase, 4e-36
3qj3_A 331 Cathepsin L-like protein; hydrolase, proteinase, l 2e-35
2o6x_A 310 Procathepsin L1, secreted cathepsin L 1; hydrolase 5e-35
3qt4_A 329 Cathepsin-L-like midgut cysteine proteinase; hydro 6e-35
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 7e-04
1xkg_A 312 DER P I, major mite fecal allergen DER P 1; major 1e-34
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 9e-04
1cs8_A 316 Human procathepsin L; prosegment, propeptide, inhi 6e-34
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 7e-04
3pdf_A 441 Cathepsin C, dipeptidyl peptidase 1; two domains, 8e-17
3bwk_A 243 Cysteine protease falcipain-3; malaria, hydrolase; 4e-15
3f5v_A 222 DER P 1 allergen; allergy, asthma, DUST mites, gly 7e-15
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 6e-04
3ioq_A 213 CMS1MS2; caricaceae, cysteine protease, papain fam 1e-14
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 5e-04
1ppo_A 216 Protease omega; hydrolase(thiol protease); 1.80A { 1e-14
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 4e-04
1s4v_A 229 Cysteine endopeptidase; KDEL ER retention signal, 2e-14
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 3e-04
1cqd_A 221 Protein (protease II); cysteine protease, glycopro 2e-14
1cqd_A221 Protein (protease II); cysteine protease, glycopro 4e-04
2oul_A 241 Falcipain 2; cysteine protease, inhibitor, macromo 2e-14
3kwz_A 215 Cathepsin K; enzyme inhibitor, covalent reversible 2e-14
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 4e-04
3f75_A 224 Toxopain-2, cathepsin L protease; medical structur 2e-14
2bdz_A 214 Mexicain; cysteine protease, peptidase_C1, papain- 2e-14
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 2e-14
1iwd_A 215 Ervatamin B; cysteine protease, alpha-beta protein 2e-14
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 3e-04
2cio_A 212 Papain; hydrolase/inhibitor, complex hydrolase/inh 2e-14
3ovx_A 218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 2e-14
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 6e-04
3p5u_A 220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 2e-14
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 6e-04
1yal_A 218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 3e-14
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 3e-04
2fo5_A 262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 3e-14
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 5e-04
3u8e_A 222 Papain-like cysteine protease; papain-like cystein 3e-14
1o0e_A 208 Ervatamin C; plant cysteine protease, two domain, 3e-14
2b1m_A 246 SPE31; papain-like, sugar binding protein; HET: NA 3e-14
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 5e-05
2xu3_A 220 Cathepsin L1; hydrolase, drug design, thiol protea 4e-14
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 2e-04
3i06_A 215 Cruzipain; autocatalytic cleavage, glycoprotein, p 8e-14
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 9e-04
1m6d_A 214 Cathepsin F, catsf; papain family cysteine proteas 9e-14
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 7e-06
8pch_A 220 Cathepsin H; hydrolase, protease, cysteine protein 3e-13
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 8e-06
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 1e-12
3hhi_A 325 Cathepsin B-like cysteine protease; occluding loop 2e-11
3pbh_A 317 Procathepsin B; thiol protease, cysteine protease, 2e-11
2wbf_X 265 Serine-repeat antigen protein; SERA, malaria, vacu 5e-11
3qsd_A 254 Cathepsin B-like peptidase (C01 family); cysteine 6e-08
1deu_A 277 Procathepsin X; cysteine protease, proregion, pros 1e-07
3cbj_A 266 Cathepsin B; cathepsin B, occluding loop, chagas d 3e-07
3ois_A 291 Cysteine protease; alpha and beta, hydrolase; HET: 6e-07
3pw3_A 383 Aminopeptidase C; bleomycin, cysteine proteinase f 5e-04
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
 Score =  132 bits (334), Expect = 3e-37
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 9/153 (5%)

Query: 70  EEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYY-TKHEQGTATY--GVN 126
           EE LD    ++ + + + +QY++  +   R  I+  NLK I  +  +   G  TY   +N
Sbjct: 4   EEILD--THWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMN 61

Query: 127 RFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQD 186
              DMT  E    ++ L   ++    S      +         +S++Y+ KG V P V++
Sbjct: 62  HLGDMTSEEVVQKMTGL---KVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTP-VKN 117

Query: 187 QHLCGSCWAHSAVACLESAYAIKHNELIELSKQ 219
           Q  CGSCWA S+V  LE     K  +L+ LS Q
Sbjct: 118 QGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQ 150
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Length = 80 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
3tnx_A 363 Papain; hydrolase, cytoplasm for recombinant expre 100.0
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 100.0
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 100.0
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 100.0
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 100.0
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 100.0
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 100.0
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 100.0
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 100.0
3pdf_A 441 Cathepsin C, dipeptidyl peptidase 1; two domains, 100.0
3hhi_A 325 Cathepsin B-like cysteine protease; occluding loop 100.0
3pbh_A 317 Procathepsin B; thiol protease, cysteine protease, 100.0
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 99.96
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 99.95
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 99.95
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 99.95
3p5u_A 220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 99.95
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 99.95
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 99.95
1cqd_A221 Protein (protease II); cysteine protease, glycopro 99.95
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 99.95
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 99.95
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 99.95
1s4v_A 229 Cysteine endopeptidase; KDEL ER retention signal, 99.95
3u8e_A222 Papain-like cysteine protease; papain-like cystein 99.95
3ioq_A 213 CMS1MS2; caricaceae, cysteine protease, papain fam 99.95
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 99.94
3f75_A 224 Toxopain-2, cathepsin L protease; medical structur 99.94
2cio_A 212 Papain; hydrolase/inhibitor, complex hydrolase/inh 99.94
1o0e_A 208 Ervatamin C; plant cysteine protease, two domain, 99.94
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 99.94
2bdz_A 214 Mexicain; cysteine protease, peptidase_C1, papain- 99.94
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 99.94
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 99.94
2fo5_A 262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 99.94
3qsd_A 254 Cathepsin B-like peptidase (C01 family); cysteine 99.93
1deu_A 277 Procathepsin X; cysteine protease, proregion, pros 99.92
3cbj_A 266 Cathepsin B; cathepsin B, occluding loop, chagas d 99.91
3ois_A 291 Cysteine protease; alpha and beta, hydrolase; HET: 99.87
2wbf_X 265 Serine-repeat antigen protein; SERA, malaria, vacu 99.86
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 99.79
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 99.73
2e01_A 457 Cysteine proteinase 1; bleomycin hydrolase, thiol 99.62
3pw3_A 383 Aminopeptidase C; bleomycin, cysteine proteinase f 99.32
2cb5_A 453 Protein (bleomycin hydrolase); aminopeptidase, cys 99.23
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 96.28
3gax_A120 Cystatin-C; cysteine protease inhibitor, 3D domain 88.76
2w9q_A87 Multicystatin; protease inhibitor, thiol protease 88.3
1eqk_A102 Oryzacystatin-I; alpha and beta proteins, cystatin 85.98
1roa_A122 Cystatin D; inhibitor of cysteine pepidases, prote 80.94
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
Probab=100.00  E-value=1.8e-54  Score=403.37  Aligned_cols=184  Identities=26%  Similarity=0.357  Sum_probs=129.6

Q ss_pred             eEeeecccccccchhhhhhhccCCCCCCccccccccchhHhHHHHHHHHHHHHhCCccCChHHHHHHHHHHHHHHHHHHH
Q psy14862         33 HTYLGWHPRWTGRVHNLILQRSQPNSYGSEEASTFDLEEFLDHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDY  112 (263)
Q Consensus        33 ~~~~~~~~~w~~~~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~F~~f~~~y~K~Y~s~~E~~~R~~iF~~Nl~~I~~  112 (263)
                      |+...|.++|..-+ .|..-......++...-+..+|.+++++..+|++|+++|+|.|.+.+|+.+|+.||++|+++|++
T Consensus        21 ~~~~~~~~~~~~~~-~~~~~~~~~~~~s~~~y~~~dl~s~~~~~~lf~~f~~~~~K~Y~~~~E~~~R~~iF~~Nl~~I~~   99 (363)
T 3tnx_A           21 TAAAKFERQHMDSP-DLGTDDDDKMDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDE   99 (363)
T ss_dssp             ----------------------------------CCSSCHHHHHHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhccccCccccCCh-hhhhccCCcccccccCCChhhhcCHHHHHHHHHHHHHHcCCcCCCHHHHHHHHHHHHHHHHHHHH
Confidence            55677999999863 33332221111222222344677788899999999999999999999999999999999999999


Q ss_pred             hccCCCCceEEEeccCCCCChHHHhcccCCCchhhhhhccccCcccccCCCCCCCCCcccccccCCCCCCcccCCCCCch
Q psy14862        113 YTKHEQGTATYGVNRFADMTDSEFNHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGS  192 (263)
Q Consensus       113 ~N~~~~~s~~~giN~FsDlT~eEf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~s~DWR~~g~Vtp~VknQg~CGS  192 (263)
                      ||+++ .+|++|+|+|+|||.+||++++++.......  ...............+||++||||++|+||| |||||.|||
T Consensus       100 ~N~~~-~sy~~g~N~FaDlT~eEf~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~lP~s~DWR~~g~Vtp-VkdQG~CGS  175 (363)
T 3tnx_A          100 TNKKN-NSYWLGLNVFADMSNDEFKEKYTGSIAGNYT--TTELSYEEVLNDGDVNIPEYVDWRQKGAVTP-VKNQGSCGS  175 (363)
T ss_dssp             HTTSC-CSEEECSCTTTTSCHHHHHHHHSCSSCSCCC--CSSSSSSCCCCCSCCCCCSCEEGGGGTCCCC-CCBCCSSBC
T ss_pred             HHcCC-CCeEEeccccccCCHHHHHHHhccccccccc--ccccccccccCcccCCCCcceecccCCCCCC-CccCCcCCc
Confidence            99885 7999999999999999999988876543221  0000111111123457999999999999999 999999999


Q ss_pred             hHHHHhhhHHHHHHHHHcCcceecCCCCc
Q psy14862        193 CWAHSAVACLESAYAIKHNELIELSKQPP  221 (263)
Q Consensus       193 CWAFat~~~iEs~~~I~tg~~~~LSeQqL  221 (263)
                      |||||++++||++++|++|+++.||||||
T Consensus       176 CWAFsa~~alE~~~~i~tg~~~~LSeQ~L  204 (363)
T 3tnx_A          176 AWAFSAVSTIESIIKIRTGNLNEYSEQEL  204 (363)
T ss_dssp             HHHHHHHHHHHHHHHHHHSCCCCBCHHHH
T ss_pred             hhhhhhcccHHHHHHHHcCCCCCcCHHHH
Confidence            99999999999999999999999999999
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>3gax_A Cystatin-C; cysteine protease inhibitor, 3D domain swapping, protein AGG amyloid, protein engineering, twinning; 1.70A {Homo sapiens} SCOP: d.17.1.2 PDB: 1g96_A 1tij_A 3qrd_A 3ps8_A 3nx0_A 3sva_A 3s67_A 1r4c_A Back     alignment and structure
>2w9q_A Multicystatin; protease inhibitor, thiol protease inhibitor, hydrolase inhibitor; 2.50A {Solanum tuberosum} PDB: 2w9p_A Back     alignment and structure
>1eqk_A Oryzacystatin-I; alpha and beta proteins, cystatin-like fold, cystatin/monellin superfamily, phytocystatin family; NMR {Oryza sativa japonica group} SCOP: d.17.1.2 Back     alignment and structure
>1roa_A Cystatin D; inhibitor of cysteine pepidases, protein binding; 1.80A {Homo sapiens} SCOP: d.17.1.2 PDB: 1rn7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 263
d1xkga1 302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1e-17
d1cs8a_ 316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 4e-16
g8pch.1 228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 4e-13
d1m6da_ 214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 9e-12
d1ppoa_ 216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 1e-11
d1yala_ 218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 1e-11
d1khqa_ 212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 2e-11
d2oula1 241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 2e-11
d1cqda_ 216 d.3.1.1 (A:) Proline-specific cysteine protease {G 2e-11
d2r6na1 215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 3e-11
d1o0ea_ 208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 3e-11
d2h7ja1 217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 5e-11
d1fh0a_ 221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 6e-11
d1aeca_ 218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 7e-11
d1iwda_ 215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 1e-10
d1s4va_ 224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 2e-10
d1me4a_ 215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 1e-09
d1gmya_ 254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 5e-09
g1k3b.1 233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 3e-08
d1deua_ 275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 2e-06
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Major mite fecal allergen der p 1
species: House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]

 Score = 78.5 bits (192), Expect = 1e-17
 Identities = 31/145 (21%), Positives = 61/145 (42%), Gaps = 10/145 (6%)

Query: 77  NQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKHEQGTATYGVNRFADMTDSEF 136
             F+++ + + + Y +  + E     F  ++K +              +N  +D++  EF
Sbjct: 3   KTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGG--------AINHLSDLSLDEF 54

Query: 137 -NHGLSSLDWEQIENLKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWA 195
            N  L S +  +    +      +   S +      I+ +    V P ++ Q  CGS WA
Sbjct: 55  KNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTP-IRMQGGCGSAWA 113

Query: 196 HSAVACLESAYAIKHNELIELSKQP 220
            S VA  ESAY    ++ ++L++Q 
Sbjct: 114 FSGVAATESAYLAYRDQSLDLAEQE 138
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 100.0
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 100.0
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 99.93
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 99.93
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 99.93
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 99.93
d1ppoa_ 216 Caricain (protease omega) {Papaya (Carica papaya) 99.93
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 99.93
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 99.93
d1khqa_ 212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 99.93
d1deua_ 275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 99.93
d1s4va_ 224 Vignain (bean endopeptidase) {Castor bean (Ricinus 99.92
d1me4a_ 215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 99.92
d1o0ea_ 208 Ervatamin C {East indian rosebay (Ervatamia corona 99.92
d1m6da_ 214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1iwda_ 215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 99.92
d1aeca_ 218 Actinidin {Chinese gooseberry or kiwifruit (Actini 99.92
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 99.92
g1k3b.1 233 Cathepsin C (dipeptidyl peptidase I), catalytic do 99.91
d1gmya_ 254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 99.91
d3gcba_ 458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 94.78
d2cb5a_ 453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 93.79
d1r4ca_110 Cystatin C {Human (Homo sapiens) [TaxId: 9606]} 91.49
d1roaa_111 Cystatin D {Human (Homo sapiens) [TaxId: 9606]} 88.53
d1cewi_108 Cystatin {Chicken (Gallus gallus) [TaxId: 9031]} 87.06
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin L
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.5e-49  Score=359.30  Aligned_cols=174  Identities=31%  Similarity=0.478  Sum_probs=149.4

Q ss_pred             HHHHHHHHHHHHhCCccCChHHHHHHHHHHHHHHHHHHHhccC---CCCceEEEeccCCCCChHHHhcccCCCchhhhhh
Q psy14862         74 DHGNQFKDFVREYERQYDSDSEIERRFDIFRNNLKTIDYYTKH---EQGTATYGVNRFADMTDSEFNHGLSSLDWEQIEN  150 (263)
Q Consensus        74 ~~~~~F~~f~~~y~K~Y~s~~E~~~R~~iF~~Nl~~I~~~N~~---~~~s~~~giN~FsDlT~eEf~~~~~~~~~~~~~~  150 (263)
                      .++.+|++||++|+|.|.+ .|+.+|+.||++|+++|++||++   ++.+|++|+|+|+|||.|||.+++++......  
T Consensus         7 ~l~~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~~--   83 (316)
T d1cs8a_           7 SLEAQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKP--   83 (316)
T ss_dssp             GGHHHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCCC--
T ss_pred             HHHHHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhcccccccc--
Confidence            4678999999999999977 57789999999999999999986   45699999999999999999998876554311  


Q ss_pred             ccccCcccccCCCCCCCCCcccccccCCCCCCcccCCCCCchhHHHHhhhHHHHHHHHHcCcceecCCCCc---------
Q psy14862        151 LKSTFETYSFNSSNSYGLAESINYKDKGKVLPKVQDQHLCGSCWAHSAVACLESAYAIKHNELIELSKQPP---------  221 (263)
Q Consensus       151 ~~~~~~~~~~~~~~~~~lP~s~DWR~~g~Vtp~VknQg~CGSCWAFat~~~iEs~~~I~tg~~~~LSeQqL---------  221 (263)
                        . ... ........+||++||||++|+|+| |||||.||||||||+++++|++++|+++.++.||+|||         
T Consensus        84 --~-~~~-~~~~~~~~~lP~s~Dwr~~g~vtp-VkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~~~~~~  158 (316)
T d1cs8a_          84 --R-KGK-VFQEPLFYEAPRSVDWREKGYVTP-VKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGN  158 (316)
T ss_dssp             --S-CCE-ECCCCTTCCCCSCEEGGGGTCCCC-CCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGGGTC
T ss_pred             --c-cCc-cccCcccccCCCceECCcCCcccc-cccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhccccccC
Confidence              1 111 111223457999999999999999 99999999999999999999999999999999999999         


Q ss_pred             ------------------------------------------------------------c-----------------cc
Q psy14862        222 ------------------------------------------------------------K-----------------TH  224 (263)
Q Consensus       222 ------------------------------------------------------------K-----------------~~  224 (263)
                                                                                  |                 .+
T Consensus       159 ~~c~gg~~~~a~~y~~~~g~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~gpv~v~i~~~~~~  238 (316)
T d1cs8a_         159 EGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGHES  238 (316)
T ss_dssp             CGGGCBCHHHHHHHHHHHTCEEBTTTSCCCSSCCCCCCCGGGEEECCCCEEECCSCHHHHHHHHHHHCCEEEEECCCSHH
T ss_pred             CCCCCCchHHHHHHHHhcCcccccccccccccccccccccccccccccccccccCcHHHHHHHHHHhCCeEEEEEeccch
Confidence                                                                        0                 67


Q ss_pred             CCCCCCccccCCCCcCCCCCCCCCeEEEEEEEecC
Q psy14862        225 GRFYKGGVMNLPHMLCSKGPYSLNHAVLNVGYDNE  259 (263)
Q Consensus       225 f~~Y~~GV~~~~~c~~~~~~~~~nHaVliVGYG~~  259 (263)
                      |++|++|||..+.|  +  ...+||||+|||||.+
T Consensus       239 f~~y~~Gi~~~~~c--~--~~~~nHaV~iVGyG~d  269 (316)
T d1cs8a_         239 FLFYKEGIYFEPDC--S--SEDMDHGVLVVGYGFE  269 (316)
T ss_dssp             HHTEEEEEECCTTC--C--SSCCCEEEEEEEEEEE
T ss_pred             hccccCCcccCCCC--C--CCcCCEEEEEEEEccc
Confidence            99999999999877  5  5678999999999965
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r4ca_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1roaa_ d.17.1.2 (A:) Cystatin D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cewi_ d.17.1.2 (I:) Cystatin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure