Psyllid ID: psy14875

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MRPIEEASFSGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDVPGLCE
cccEEEEEEEcccccccccEEEEEEccEEEEEEEEEEEcccccccccccccccccccccccEEEcccccEEccccccccccccccccccccccccccccccccc
ccHHHHHHHcccccccccccHccccccEEEEEEEEEEEEccccccccccccccccccccccEEEcccccEEEccccccccccccEEcccccccccccccccccc
mrpieeasfsgillpsaewhtlnhkgktariTYRVRVQCDLhyfnstcttfcrprddkfghftcdsngdkvciagwkgtncetavckegchpthgkcdvpglce
mrpieeasfsgillpsaewhtlnhkgKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKegchpthgkcdvpglce
MRPIEEASFSGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDVPGLCE
*********SGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDV*****
MRPIEEASFSGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDVPGLCE
********FSGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDVPGLCE
MRPIEEASFSGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDV***C*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPIEEASFSGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDVPGLCE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query104 2.2.26 [Sep-21-2011]
P18168 1404 Protein serrate OS=Drosop yes N/A 0.990 0.073 0.669 3e-39
Q90Y57 1242 Protein jagged-1a OS=Dani yes N/A 0.961 0.080 0.54 1e-28
Q9QXX0 1218 Protein jagged-1 OS=Mus m yes N/A 0.961 0.082 0.51 2e-27
Q63722 1219 Protein jagged-1 OS=Rattu yes N/A 0.961 0.082 0.51 2e-27
P78504 1218 Protein jagged-1 OS=Homo yes N/A 0.961 0.082 0.5 8e-27
Q90Y54 1213 Protein jagged-1b OS=Dani no N/A 0.971 0.083 0.485 3e-26
Q9Y219 1238 Protein jagged-2 OS=Homo no N/A 0.961 0.080 0.48 1e-24
Q9QYE5 1247 Protein jagged-2 OS=Mus m no N/A 0.961 0.080 0.48 1e-24
P97607 1202 Protein jagged-2 (Fragmen no N/A 0.961 0.083 0.48 1e-24
O00548 723 Delta-like protein 1 OS=H no N/A 0.884 0.127 0.467 4e-19
>sp|P18168|SERR_DROME Protein serrate OS=Drosophila melanogaster GN=Ser PE=1 SV=3 Back     alignment and function desciption
 Score =  160 bits (404), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 83/103 (80%)

Query: 2   RPIEEASFSGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGH 61
           R IEE S+SG++LPS EW TL+H G+ ARITYRVRVQC + Y+N+TCTTFCRPRDD+FGH
Sbjct: 200 RLIEETSYSGVILPSPEWKTLDHIGRNARITYRVRVQCAVTYYNTTCTTFCRPRDDQFGH 259

Query: 62  FTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDVPGLCE 104
           + C S G K+C+ GW+G NCE A+CK GC P HGKCD PG CE
Sbjct: 260 YACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDRPGECE 302
Acts as a ligand for Notch (N) receptor. Essential for proper ectodermal development. Serrate represents an element in a network of interacting molecules operating at the cell surface during the differentiation of certain tissues.
Drosophila melanogaster (taxid: 7227)
>sp|Q90Y57|JAG1A_DANRE Protein jagged-1a OS=Danio rerio GN=jag1a PE=2 SV=1 Back     alignment and function description
>sp|Q9QXX0|JAG1_MOUSE Protein jagged-1 OS=Mus musculus GN=Jag1 PE=1 SV=1 Back     alignment and function description
>sp|Q63722|JAG1_RAT Protein jagged-1 OS=Rattus norvegicus GN=Jag1 PE=1 SV=2 Back     alignment and function description
>sp|P78504|JAG1_HUMAN Protein jagged-1 OS=Homo sapiens GN=JAG1 PE=1 SV=3 Back     alignment and function description
>sp|Q90Y54|JAG1B_DANRE Protein jagged-1b OS=Danio rerio GN=jag1b PE=2 SV=1 Back     alignment and function description
>sp|Q9Y219|JAG2_HUMAN Protein jagged-2 OS=Homo sapiens GN=JAG2 PE=1 SV=3 Back     alignment and function description
>sp|Q9QYE5|JAG2_MOUSE Protein jagged-2 OS=Mus musculus GN=Jag2 PE=2 SV=2 Back     alignment and function description
>sp|P97607|JAG2_RAT Protein jagged-2 (Fragment) OS=Rattus norvegicus GN=Jag2 PE=2 SV=1 Back     alignment and function description
>sp|O00548|DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens GN=DLL1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
332020153 1189 Protein jagged-1 [Acromyrmex echinatior] 0.971 0.084 0.722 6e-39
270010674 1246 hypothetical protein TcasGA2_TC010113 [T 0.961 0.080 0.72 1e-38
189239617 1303 PREDICTED: serrate [Tribolium castaneum] 0.961 0.076 0.72 1e-38
242017193 1214 Jagged-2 precursor, putative [Pediculus 0.971 0.083 0.693 2e-38
380026105 1203 PREDICTED: LOW QUALITY PROTEIN: protein 0.971 0.083 0.712 2e-38
328784937 1203 PREDICTED: protein jagged-1 [Apis mellif 0.971 0.083 0.712 3e-38
383859516 1215 PREDICTED: protein jagged-1b-like [Megac 0.971 0.083 0.702 4e-38
340714233 1205 PREDICTED: protein jagged-1-like [Bombus 0.971 0.083 0.702 8e-38
350422307 1205 PREDICTED: protein jagged-1-like [Bombus 0.971 0.083 0.702 9e-38
45549234 1407 serrate [Drosophila melanogaster] gi|454 0.990 0.073 0.669 1e-37
>gi|332020153|gb|EGI60597.1| Protein jagged-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 84/101 (83%)

Query: 4   IEEASFSGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFT 63
           IEEAS+SGI+LP   WHTLNH+GK A + YRVRVQC  HY+N+TCT FCRPR+D FGH+T
Sbjct: 118 IEEASYSGIVLPGPTWHTLNHQGKNANLAYRVRVQCADHYYNATCTKFCRPRNDIFGHYT 177

Query: 64  CDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDVPGLCE 104
           CD NGDKVCI GWKG +CETAVCKEGCHP HG C+V G C+
Sbjct: 178 CDENGDKVCIQGWKGVDCETAVCKEGCHPVHGHCNVSGECQ 218

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270010674|gb|EFA07122.1| hypothetical protein TcasGA2_TC010113 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189239617|ref|XP_969486.2| PREDICTED: serrate [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242017193|ref|XP_002429076.1| Jagged-2 precursor, putative [Pediculus humanus corporis] gi|212513940|gb|EEB16338.1| Jagged-2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|380026105|ref|XP_003696800.1| PREDICTED: LOW QUALITY PROTEIN: protein jagged-1-like [Apis florea] Back     alignment and taxonomy information
>gi|328784937|ref|XP_394560.2| PREDICTED: protein jagged-1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383859516|ref|XP_003705240.1| PREDICTED: protein jagged-1b-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340714233|ref|XP_003395635.1| PREDICTED: protein jagged-1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350422307|ref|XP_003493123.1| PREDICTED: protein jagged-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|45549234|ref|NP_524527.3| serrate [Drosophila melanogaster] gi|45446681|gb|AAF56678.2| serrate [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
FB|FBgn0004197 1404 Ser "Serrate" [Drosophila mela 0.990 0.073 0.669 1.7e-38
ZFIN|ZDB-GENE-011128-2 1253 jag1a "jagged 1a" [Danio rerio 0.961 0.079 0.54 1.6e-29
UNIPROTKB|F1SBK1 1218 JAG1 "Delta-like protein" [Sus 0.961 0.082 0.51 1.4e-28
UNIPROTKB|Q90819 1193 JAG1 "Delta-like protein" [Gal 0.980 0.085 0.519 3.7e-28
MGI|MGI:1095416 1218 Jag1 "jagged 1" [Mus musculus 0.961 0.082 0.51 4.9e-28
RGD|2937 1219 Jag1 "jagged 1" [Rattus norveg 0.961 0.082 0.51 6.3e-28
UNIPROTKB|Q63722 1219 Jag1 "Protein jagged-1" [Rattu 0.961 0.082 0.51 6.3e-28
UNIPROTKB|E1BDN7 1218 JAG1 "Delta-like protein" [Bos 0.961 0.082 0.49 2.1e-27
UNIPROTKB|E2QUR0 1218 JAG1 "Delta-like protein" [Can 0.961 0.082 0.5 2.1e-27
UNIPROTKB|P78504 1218 JAG1 "Protein jagged-1" [Homo 0.961 0.082 0.5 2.1e-27
FB|FBgn0004197 Ser "Serrate" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 425 (154.7 bits), Expect = 1.7e-38, P = 1.7e-38
 Identities = 69/103 (66%), Positives = 83/103 (80%)

Query:     2 RPIEEASFSGILLPSAEWHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGH 61
             R IEE S+SG++LPS EW TL+H G+ ARITYRVRVQC + Y+N+TCTTFCRPRDD+FGH
Sbjct:   200 RLIEETSYSGVILPSPEWKTLDHIGRNARITYRVRVQCAVTYYNTTCTTFCRPRDDQFGH 259

Query:    62 FTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDVPGLCE 104
             + C S G K+C+ GW+G NCE A+CK GC P HGKCD PG CE
Sbjct:   260 YACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDRPGECE 302
GO:0005886 "plasma membrane" evidence=IDA
GO:0030673 "axolemma" evidence=IDA
GO:0005154 "epidermal growth factor receptor binding" evidence=NAS
GO:0036011 "imaginal disc-derived leg segmentation" evidence=IMP
GO:0005887 "integral to plasma membrane" evidence=NAS
GO:0007219 "Notch signaling pathway" evidence=IMP;NAS
GO:0005112 "Notch binding" evidence=NAS;TAS;IPI
GO:0048749 "compound eye development" evidence=IMP;TAS
GO:0007435 "salivary gland morphogenesis" evidence=IMP;NAS
GO:0007451 "dorsal/ventral lineage restriction, imaginal disc" evidence=TAS
GO:0042688 "crystal cell differentiation" evidence=IMP;TAS
GO:0035167 "larval lymph gland hemopoiesis" evidence=IEP
GO:0042689 "regulation of crystal cell differentiation" evidence=TAS
GO:0005102 "receptor binding" evidence=NAS
GO:0016021 "integral to membrane" evidence=IEA;NAS
GO:0007431 "salivary gland development" evidence=NAS
GO:0007436 "larval salivary gland morphogenesis" evidence=IMP
GO:0035170 "lymph gland crystal cell differentiation" evidence=TAS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
GO:0007423 "sensory organ development" evidence=IMP
GO:0035017 "cuticle pattern formation" evidence=IMP
GO:0045746 "negative regulation of Notch signaling pathway" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0035214 "eye-antennal disc development" evidence=IMP
GO:0030718 "germ-line stem cell maintenance" evidence=IGI
GO:0009986 "cell surface" evidence=IDA
ZFIN|ZDB-GENE-011128-2 jag1a "jagged 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBK1 JAG1 "Delta-like protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q90819 JAG1 "Delta-like protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1095416 Jag1 "jagged 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2937 Jag1 "jagged 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q63722 Jag1 "Protein jagged-1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDN7 JAG1 "Delta-like protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUR0 JAG1 "Delta-like protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P78504 JAG1 "Protein jagged-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9QXX0JAG1_MOUSENo assigned EC number0.510.96150.0821yesN/A
Q63722JAG1_RATNo assigned EC number0.510.96150.0820yesN/A
Q90Y57JAG1A_DANRENo assigned EC number0.540.96150.0805yesN/A
P18168SERR_DROMENo assigned EC number0.66990.99030.0733yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
pfam0141463 pfam01414, DSL, Delta serrate ligand 8e-24
smart0005163 smart00051, DSL, delta serrate ligand 5e-23
>gnl|CDD|144855 pfam01414, DSL, Delta serrate ligand Back     alignment and domain information 
 Score = 85.9 bits (213), Expect = 8e-24
 Identities = 31/63 (49%), Positives = 39/63 (61%)

Query: 19 WHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKG 78
          W T  H      + Y++RV CD +Y+   C  FCRPRDD FGH+TCD NG+K C+ GW G
Sbjct: 1  WSTDLHIVGRTNLEYQIRVTCDENYYGEGCNKFCRPRDDFFGHYTCDENGNKRCLNGWMG 60

Query: 79 TNC 81
            C
Sbjct: 61 PYC 63

Length = 63
>gnl|CDD|128366 smart00051, DSL, delta serrate ligand Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 104
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 99.79
smart0005163 DSL delta serrate ligand. 99.78
KOG1225|consensus 525 99.24
KOG1225|consensus 525 98.89
KOG4289|consensus 2531 98.3
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 98.23
KOG1226|consensus 783 98.05
KOG1226|consensus 783 97.73
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 97.4
KOG1219|consensus 4289 97.09
KOG4260|consensus 350 96.85
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.8
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 95.61
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 94.75
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 94.71
KOG1218|consensus 316 94.6
PF0000832 EGF: EGF-like domain This is a sub-family of the P 93.85
KOG1217|consensus 487 93.84
KOG3607|consensus716 93.67
KOG0994|consensus 1758 93.36
KOG4289|consensus 2531 92.64
smart0018135 EGF Epidermal growth factor-like domain. 89.51
cd0005336 EGF Epidermal growth factor domain, found in epide 88.97
PF0486356 EGF_alliinase: Alliinase EGF-like domain; InterPro 88.74
KOG1219|consensus 4289 88.5
smart0017939 EGF_CA Calcium-binding EGF-like domain. 88.12
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 87.56
KOG1217|consensus 487 87.2
KOG0994|consensus 1758 85.81
smart0005163 DSL delta serrate ligand. 84.49
PHA02887126 EGF-like protein; Provisional 83.86
KOG1218|consensus 316 80.27
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information 
Probab=99.79  E-value=8.9e-21  Score=115.85  Aligned_cols=63  Identities=56%  Similarity=1.371  Sum_probs=31.7

Q ss_pred             ceeeeecCceeEEEecEEEecCCCCCCCCCCCCCCCCCCCCCceEECCCCCeecCCCCCCCCC
Q psy14875         19 WHTLNHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNC   81 (104)
Q Consensus        19 W~~~~~~~~~~~l~~~~r~~C~~g~~G~~C~~~C~~~~~~~g~g~C~~~G~c~C~~Gw~G~~C   81 (104)
                      |++..+.+..+.|++++|++|+++|||+.|+++|.|+++..+||+|+++|..+|.+||+|++|
T Consensus         1 W~~~~~~~~~~~l~~~~rv~C~~nyyG~~C~~~C~~~~d~~ghy~Cd~~G~~~C~~Gw~G~~C   63 (63)
T PF01414_consen    1 WNTDTHIGNRTSLSYRIRVVCDENYYGPNCSKFCKPRDDSFGHYTCDSNGNKVCLPGWTGPNC   63 (63)
T ss_dssp             ----------------------TTEETTTT-EE---EEETTEEEEE-SS--EEE-TTEESTTS
T ss_pred             CccccccCceeEEEEEEEEECCCCCCCccccCCcCCCcCCcCCcccCCCCCCCCCCCCcCCCC
Confidence            889999999999999999999999999999999999888889999999999999999999988

In Caenorhabditis elegans, two DSL genes, lag-2 and apx-1, influence different cell fate decisions during development []. Molecular interaction between Notch and Serrate, another EGF-homologous transmembrane protein containing a region of striking similarity to Delta, has been shown and the same two EGF repeats of Notch may also constitute a Serrate binding domain [, ].; GO: 0007154 cell communication, 0016020 membrane; PDB: 2VJ2_A.
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG3607|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 5e-19
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure 
Iteration: 1

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 47/75 (62%)
Query: 29  ARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKE 88
             I  R  V CD +Y+   C  FCRPRDD FGH+ CD NG+K C+ GW G  C  A+C++
Sbjct: 11  GSIEGRSAVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQ 70
Query: 89  GCHPTHGKCDVPGLC 103
           GC P HG C +PG C
Sbjct: 71  GCSPKHGSCKLPGDC 85

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-17
2ygq_A 324 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-04
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
 Score = 72.0 bits (177), Expect = 1e-17
 Identities = 39/81 (48%), Positives = 49/81 (60%)

Query: 23  NHKGKTARITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCE 82
           +H      I  R  V CD +Y+   C  FCRPRDD FGH+ CD NG+K C+ GW G  C 
Sbjct: 5   HHHHHHGSIEGRSAVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECN 64

Query: 83  TAVCKEGCHPTHGKCDVPGLC 103
            A+C++GC P HG C +PG C
Sbjct: 65  RAICRQGCSPKHGSCKLPGDC 85
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.44
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.16
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.01
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.83
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.82
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.82
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.77
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.75
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.69
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 98.62
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 98.56
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 98.43
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.41
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.34
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.26
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.16
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.05
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 97.95
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 97.93
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.91
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.72
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.65
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.6
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 97.59
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 97.46
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.31
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.22
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.19
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.05
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 97.04
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 96.95
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 96.83
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 96.76
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 96.74
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 96.68
2bou_A143 EGF-like module containing mucin-like hormone rece 96.65
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.57
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.46
2vh0_B134 Activated factor XA light chain; serine protease, 96.23
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.19
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 96.12
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.12
2bou_A143 EGF-like module containing mucin-like hormone rece 96.03
1a3p_A45 Epidermal growth factor; disulfide connectivities, 95.99
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 95.8
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 95.65
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 95.5
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 95.43
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 95.41
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 95.2
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 95.17
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 95.08
2ddu_A 387 Reelin; beta-jelly-roll, signaling protein; 2.05A 94.78
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 94.65
1aut_L114 Activated protein C; serine proteinase, plasma cal 94.65
1nql_B53 Epidermal growth factor; cell surface receptor, ty 94.31
4fbr_A 267 Lectin, myxobacterial hemagglutinin; beta-barrel, 94.21
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 94.13
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 94.1
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 94.06
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 93.87
2y38_A403 Laminin subunit alpha-5; structural protein, cell 93.73
3g5c_A510 ADAM 22; alpha/beta fold, cross-linked domain, cel 93.7
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 93.45
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 93.16
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 93.14
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 92.99
1a3p_A45 Epidermal growth factor; disulfide connectivities, 92.06
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 91.93
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 91.8
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 91.79
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 91.59
3v65_B 386 Low-density lipoprotein receptor-related protein; 91.58
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 91.35
1nql_B53 Epidermal growth factor; cell surface receptor, ty 90.02
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 89.52
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 89.5
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 89.48
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 89.2
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 89.04
2k2s_B61 Micronemal protein 6; microneme protein complex, c 88.56
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 88.26
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 88.15
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 88.13
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 87.7
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 87.66
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 86.78
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 86.52
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 85.99
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 85.59
2k2s_B61 Micronemal protein 6; microneme protein complex, c 85.33
2vh0_B134 Activated factor XA light chain; serine protease, 85.24
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 84.96
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 84.9
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 84.7
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 84.61
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 84.02
2i9a_A145 Urokinase-type plasminogen activator; growth facto 83.9
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 83.68
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 83.6
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 83.24
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 80.23
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
Probab=99.44  E-value=2.6e-14  Score=99.70  Aligned_cols=73  Identities=52%  Similarity=1.301  Sum_probs=58.4

Q ss_pred             EEecEEEecCCCCCCCCCCCCCCCCCCCCCceEECCCCCeecCCCCCCCCCCCCccCCCCcCCCceeCCCCee
Q psy14875         31 ITYRVRVQCDLHYFNSTCTTFCRPRDDKFGHFTCDSNGDKVCIAGWKGTNCETAVCKEGCHPTHGKCDVPGLC  103 (104)
Q Consensus        31 l~~~~r~~C~~g~~G~~C~~~C~~~~~~~g~g~C~~~G~c~C~~Gw~G~~C~~~~C~~~C~~~~G~C~~p~~C  103 (104)
                      +...++++|++||+|..|+..|.+..++.+||+|+.+|+|+|.+||+|..|++++|...|+..||.|+.+++|
T Consensus        13 ~~~~~~c~C~~g~~G~~C~~~C~~~~~c~~~g~C~~~g~C~C~~G~~G~~C~~~~C~~~C~~~~g~C~~~~~C   85 (169)
T 2vj2_A           13 IEGRSAVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDC   85 (169)
T ss_dssp             --------CCTTEETTTTCEECCCEEETTEEEEECSSCCEEECTTEESTTSCEECCCTTCCTTTEECSSTTCC
T ss_pred             cccCeeeeCCCcCcCCCcccccCCCCCcCCCCEeCCCCeeECCCCCcCCCCCCCCCCCCCCCCCcccCCCCee
Confidence            4456789999999999999999886668889999999999999999999999999999997338999877766
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 98.09
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 98.04
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 97.82
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.18
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.04
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.92
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 96.84
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.84
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.65
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 96.52
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.5
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 96.41
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 95.83
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 95.59
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 95.41
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.32
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 95.28
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 95.04
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 95.0
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 94.51
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 94.34
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 94.32
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 94.13
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 94.12
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 93.98
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 93.44
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 93.08
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 92.51
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 91.56
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 91.42
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 90.86
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 90.52
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 90.37
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 90.04
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 89.01
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 88.88
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 88.26
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 87.88
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 87.75
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 87.68
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 87.2
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 85.47
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 85.28
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Integrin beta EGF-like domains
domain: Integrin beta EGF-like domains
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.09  E-value=2.7e-07  Score=46.33  Aligned_cols=25  Identities=36%  Similarity=0.776  Sum_probs=22.4

Q ss_pred             CCCCceEECCCCCeecCCCCCCCCCC
Q psy14875         57 DKFGHFTCDSNGDKVCIAGWKGTNCE   82 (104)
Q Consensus        57 ~~~g~g~C~~~G~c~C~~Gw~G~~C~   82 (104)
                      .|++||.|+ -|.|+|.+||+|.+|+
T Consensus         4 ~C~ghG~C~-CG~C~C~~gw~G~~CN   28 (31)
T d1jv2b4           4 MCSGHGQCS-CGDCLCDSDWTGYYCN   28 (31)
T ss_dssp             CSCCCTTCC-STTTCCCTTEESSSSC
T ss_pred             eccCCCccc-CCceEccCCccccccc
Confidence            367899998 8999999999999996
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure