Diaphorina citri psyllid: psy14886

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-----
MDNQADLTWTCEAFGVPDVTYSWFRNGELLNSETLPLEDQDRYFIQDNVLTIRYLNPERDPAMYQCRAKNQLKTRYSSAQLRVLTLKPSFKKRPLESETYAGEGGNVTIFCNPEAAPKPKFVWKKDGNIIGSGGRRKIFENGNLLISPVSRDDSGIYSCTATNVHGMDESKGRLIVLHGPSYYEQLPPKITIAAHRNLQLRCSAHTEELLDVAYIWTHNGVRIGNMDLNELETPNINIDGGLLEITNASFADAGEYECVVKSTVGKISTKTTVIVEGPPGLPGGVQVVEVHKTSATIQWTDGATNGRPITHYKIIARTNWNSTWFNVSEHVIGKEVDRYTGRKEASIENVLVPWSTYEFKVIAGNELGYGEPSSPSPQYNTPADKPYQAPSRIGGGGGKIGDLSISWEPLPREKQNAPNIYYKIFWRKKNDTEFQSETLKEYGNVGIAVVRIPSEFYYTEYEVKVQAINDVGPGPESEVVTIWHDPLVIISYVCQGDLKLCLPRD
ccccccEEEEEEEEECcccEEEEEEccEEcccccccccccccEEECccEEEEEccccccccCEEEEEEEEccEEEEEEEEEEEEECccccCCcccccCEEEECccEEEEEcccccccccEEEEEEccCEccccccEEEcccccEEEccccccccCEEEEEEEEccccCEEEEEEEEECcccCECcccccEEEEccccEEEEEEEEEcccccEEEEEEEccEEcccccccccccccEEccccEEEEEcccccccEEEEEEEEcccccCEEEEEEEEEccccccccCEEEEEEccEEEEEEEccccccccccEEEEEEECccccccEEEEECcccCEEEEEcccCEEEEEcccccccEEEEEEEEEccccccccccccccEEccccccccccccCEEECccccCEEEEEECcccccccccccEEEEEEEEcccccccEEEEEEEccccCEEEEccccccccEEEEEEEEEcccccccccccEEEECccccccccccccccccccccc
*DNQADLTWTCEAFGVPDVTYSWFRNGELLNSETLPLEDQDRYFIQDNVLTIRYLNPERDPAMYQCRAKNQLKTRYSSAQLRVLTLKPSFKKRPLESETYAGEGGNVTIFCNPEAAPKPKFVWKKDGNIIGSGGRRKIFENGNLLISPVSRDDSGIYSCTATNVHGMDESKGRLIVLHGPSYYEQLPPKITIAAHRNLQLRCSAHTEELLDVAYIWTHNGVRIGNMDLNELETPNINIDGGLLEITNASFADAGEYECVVKSTVGKISTKTTVIVEGPPGLPGGVQVVEVHKTSATIQWTDGATNGRPITHYKIIARTNWNSTWFNVSEHVIGKEVDRYTGRKEASIENVLVPWSTYEFKVIAGNELGYGEPSS*************************IGDLSISWEPLPREKQNAPNIYYKIFWRKKNDTEFQSETLKEYGNVGIAVVRIPSEFYYTEYEVKVQAINDVGPGPESEVVTIWHDPLVIISYVCQGDLKL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNQADLTWTCEAFGVPDVTYSWFRNGELLNSETLPLEDQDRYFIQDNVLTIRYLNPERDPAMYQCRAKNQLKTRYSSAQLRVLTLKPSFKKRPLESETYAGEGGNVTIFCNPEAAPKPKFVWKKDGNIIGSGGRRKIFENGNLLISPVSRDDSGIYSCTATNVHGMDESKGRLIVLHGPSYYEQLPPKITIAAHRNLQLRCSAHTEELLDVAYIWTHNGVRIGNMDLNELETPNINIDGGLLEITNASFADAGEYECVVKSTVGKISTKTTVIVEGPPGLPGGVQVVEVHKTSATIQWTDGATNGRPITHYKIIARTNWNSTWFNVSEHVIGKEVDRYTGRKEASIENVLVPWSTYEFKVIAGNELGYGEPSSPSPQYNTPADKPYQAPSRIGGGGGKIGDLSISWEPLPREKQNAPNIYYKIFWRKKNDTEFQSETLKEYGNVGIAVVRIPSEFYYTEYEVKVQAINDVGPGPESEVVTIWHDPLVIISYVCQGDLKLCLPRD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Contactin Required for organization of septate junctions and paracellular barrier functions. Septate junctions, which are the equivalent of vertebrates tight junctions, are characterized by regular arrays of transverse structures that span the intermembrane space and form a physical barrier to diffusion.confidentQ9VN14

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005919 [CC]pleated septate junctionprobableGO:0070160, GO:0005575, GO:0005911, GO:0043296, GO:0030054, GO:0005918
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 1-33,47-485
View the alignment between query and template
View the model in PyMOL
Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 1-315,326-482
View the alignment between query and template
View the model in PyMOL