Diaphorina citri psyllid: psy14889

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---

MWSCHSVNVGQFTIQCCDGDFCNNGSFPILPPSYRELPEYAQRYDYILKLSMAILGPVIVLGMLAAVIVLFMRRNHRKKLLAARAIQSDPDCFLADADLLRATAAGDSTLREYLDASLTSGSGSGLPLLIQRTLAKQISLSECIGKGRYGEVWRGVWHGENVAVKIFFSRDEASWSRETEIYSTVLLRHENILGYIGSDMTSRNSCTQLWLVTHYHSFGSLYDHLNRTTLNHHQMMKICLSIVNGLVHLHTEIFGTQGKPAIAHRDIKSKNILVKTNGTCVIADFGLAVSYSQLSNKMDIPPNPRVGTKRYMSPEILDESINMDCFESFKKADIYALGLVLWEVCRRTKANGIFEEYKAPYHDLVPMDPSFDDMRKVICIDQQRPVLPNRWVSDSTLNAMTKVMKECWHQNANVRLSALRVKKTLIKLACADMYIHCSDGDMM

ccEECccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEccccHHHHHHccccccccccccHHHHHHcccccccHHHHHccccccccccccccHHcccccccccEEEEEECccccEEEEEECcccEEEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEECcccccccEEEEEEcccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccCEECccccccEEECcccCEEEECcccccEEcccccccccccccccccccccccccccccccccccccccHHcEEccHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccc

MWSC***NVGQFTIQCCDGDFCNNGSFPILPPS*********RYDYILKLSMAILGPVIVLGMLAAVIVLFMRRNHRKK*****************************TLR****ASLTSGSGSGLPLLIQRTLAKQISLSECIGKGRYGEVWRGVWHGENVAVKIFFSRDEASWSRETEIYSTVLLRHENILGYIGSDMTSRNSCTQLWLVTHYHSFGSLYDHLNRTTLNHHQMMKICLSIVNGLVHLHTEIFGTQGKPAIAHRDIKSKNILVKTNGTCVIADFGLAVSYSQLSNKMDIPPNPRVGTKRYMSPEILDESINMDCFESFKKADIYALGLVLWEVCRRTKANGIFEEYKAPYHDLVPMDPSFDDMRKVICIDQQRPVLPNRWVSDSTLNAMTKVMKECWHQNANVRLSALRVKKTLIKLACA************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Activin receptor type-1	On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin.	very confident	Q90ZK6
Activin receptor type-1	On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis.	confident	Q04771
Activin receptor type-1	On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. May also bind activin.	confident	Q28041

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005025 [MF]	transforming growth factor beta receptor activity, type I	confident	GO:0038023, GO:0060089, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0016740, GO:0005024, GO:0004675, GO:0004674, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0004672, GO:0019199
GO:0003230 [BP]	cardiac atrium development	confident	GO:0003205, GO:0007507, GO:0032501, GO:0044707, GO:0072358, GO:0048856, GO:0044767, GO:0072359, GO:0048513, GO:0008150, GO:0048731, GO:0032502, GO:0007275, GO:0044699
GO:0014070 [BP]	response to organic cyclic compound	confident	GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0018107 [BP]	peptidyl-threonine phosphorylation	confident	GO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0045446 [BP]	endothelial cell differentiation	confident	GO:0032502, GO:0060429, GO:0003158, GO:0030154, GO:0009888, GO:0008150, GO:0044763, GO:0048869, GO:0030855, GO:0009987, GO:0044699, GO:0048856
GO:0010596 [BP]	negative regulation of endothelial cell migration	confident	GO:0030336, GO:0040013, GO:0030334, GO:0010594, GO:0010632, GO:0010633, GO:0065007, GO:0051271, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:0051239, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0001837 [BP]	epithelial to mesenchymal transition	confident	GO:0030154, GO:0048468, GO:0009653, GO:0007275, GO:0044699, GO:0014031, GO:0048864, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0008150, GO:0048513, GO:0071840, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0044763, GO:0060485, GO:0000904, GO:0044707, GO:0048856, GO:0048731
GO:0045669 [BP]	positive regulation of osteoblast differentiation	confident	GO:0051094, GO:0050793, GO:0045595, GO:0050794, GO:0045597, GO:0045667, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0030278, GO:0050789, GO:0048522
GO:0016361 [MF]	activin receptor activity, type I	confident	GO:0038023, GO:0060089, GO:0017002, GO:0016772, GO:0003824, GO:0016301, GO:0016740, GO:0004675, GO:0004674, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0004672, GO:0019199, GO:0016773
GO:0050790 [BP]	regulation of catalytic activity	confident	GO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0032924 [BP]	activin receptor signaling pathway	confident	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699, GO:0007178
GO:0051216 [BP]	cartilage development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001558 [BP]	regulation of cell growth	confident	GO:0040008, GO:0050794, GO:0008150, GO:0065007, GO:0051128, GO:0050789
GO:2000017 [BP]	positive regulation of determination of dorsal identity	confident	GO:0051094, GO:0050793, GO:0051240, GO:2000015, GO:0008150, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0048185 [MF]	activin binding	confident	GO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0009968 [BP]	negative regulation of signal transduction	confident	GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0048514 [BP]	blood vessel morphogenesis	confident	GO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0005524 [MF]	ATP binding	confident	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0042803 [MF]	protein homodimerization activity	confident	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0042118 [BP]	endothelial cell activation	confident	GO:0008150, GO:0001775, GO:0009987, GO:0044763, GO:0044699
GO:0003143 [BP]	embryonic heart tube morphogenesis	confident	GO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048513, GO:0048729, GO:0060562, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0008150, GO:0035295, GO:0007507, GO:0044707, GO:0048856, GO:0044767, GO:0048731
GO:0045165 [BP]	cell fate commitment	confident	GO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0046332 [MF]	SMAD binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0010862 [BP]	positive regulation of pathway-restricted SMAD protein phosphorylation	confident	GO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0023051, GO:0010647, GO:0010646, GO:0050789, GO:0080090, GO:0010604, GO:0090100, GO:0009966, GO:0009967, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0090092, GO:0045937, GO:0060255, GO:0031323, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0060393, GO:0001932, GO:0001934, GO:0048522
GO:0043025 [CC]	neuronal cell body	confident	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0030509 [BP]	BMP signaling pathway	confident	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0007178, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0050431 [MF]	transforming growth factor beta binding	confident	GO:0019955, GO:0003674, GO:0019838, GO:0005515, GO:0005488
GO:0045177 [CC]	apical part of cell	confident	GO:0005575, GO:0044464, GO:0005623
GO:0035107 [BP]	appendage morphogenesis	confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048736, GO:0009653, GO:0007275, GO:0044699
GO:0016477 [BP]	cell migration	confident	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0009986 [CC]	cell surface	confident	GO:0005575, GO:0044464, GO:0005623
GO:0023014 [BP]	signal transduction by phosphorylation	confident	GO:0044700, GO:0051716, GO:0008152, GO:0016310, GO:0050896, GO:0009987, GO:0044237, GO:0050794, GO:0008150, GO:0006796, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0006793, GO:0007154, GO:0050789, GO:0044699
GO:0070724 [CC]	BMP receptor complex	confident	GO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0030510 [BP]	regulation of BMP signaling pathway	confident	GO:0090092, GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	confident	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0051291 [BP]	protein heterooligomerization	confident	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0033993 [BP]	response to lipid	confident	GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0007179 [BP]	transforming growth factor beta receptor signaling pathway	confident	GO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0048179 [CC]	activin receptor complex	confident	GO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0004702 [MF]	receptor signaling protein serine/threonine kinase activity	confident	GO:0004674, GO:0016773, GO:0005057, GO:0003824, GO:0016301, GO:0060089, GO:0016740, GO:0003674, GO:0004871, GO:0004672, GO:0016772
GO:0030501 [BP]	positive regulation of bone mineralization	confident	GO:0070169, GO:0045778, GO:0050793, GO:0051240, GO:0051094, GO:0070167, GO:0008150, GO:0048518, GO:2000026, GO:0051239, GO:0030500, GO:0065007, GO:0030278, GO:0050789
GO:0042981 [BP]	regulation of apoptotic process	confident	GO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0005938 [CC]	cell cortex	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0001701 [BP]	in utero embryonic development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0001707 [BP]	mesoderm formation	confident	GO:0032502, GO:0048598, GO:0048856, GO:0001704, GO:0048332, GO:0007498, GO:0007369, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0044699, GO:0048729, GO:0009653, GO:0007275, GO:0048646, GO:0044707
GO:0007389 [BP]	pattern specification process	confident	GO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0045603 [BP]	positive regulation of endothelial cell differentiation	confident	GO:0051094, GO:0050793, GO:0045595, GO:0050794, GO:0045597, GO:0045601, GO:0065007, GO:0030856, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0030858, GO:0050789, GO:0048522
GO:0045602 [BP]	negative regulation of endothelial cell differentiation	confident	GO:0051093, GO:0050793, GO:0045595, GO:0050794, GO:0008150, GO:0045596, GO:0045601, GO:0065007, GO:0030856, GO:0030857, GO:0051239, GO:0048519, GO:2000026, GO:0050789, GO:0048523
GO:0030425 [CC]	dendrite	confident	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0060389 [BP]	pathway-restricted SMAD protein phosphorylation	confident	GO:0016310, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0044267, GO:0051716, GO:0044260, GO:0071704, GO:0065007, GO:0006468, GO:0044238, GO:0009987, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0007154, GO:0007178, GO:0044700, GO:0019538, GO:0050896, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0008150
GO:0051260 [BP]	protein homooligomerization	confident	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0001938 [BP]	positive regulation of endothelial cell proliferation	confident	GO:0008284, GO:0042127, GO:0050678, GO:0050679, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0001936, GO:0050789, GO:0048522
GO:0001937 [BP]	negative regulation of endothelial cell proliferation	confident	GO:0042127, GO:0008285, GO:0050678, GO:0050680, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523, GO:0001936
GO:0051491 [BP]	positive regulation of filopodium assembly	probable	GO:0051130, GO:0051489, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0048518, GO:0008150, GO:0031346, GO:0031344, GO:0050794, GO:0048522
GO:1901164 [BP]	negative regulation of trophoblast cell migration	probable	GO:2000242, GO:2000241, GO:0050789, GO:0065007, GO:2000145, GO:1901163, GO:0030336, GO:0030334, GO:0050793, GO:0051271, GO:0050794, GO:0043900, GO:0051270, GO:0008150, GO:0051239, GO:0048519, GO:0032879, GO:0040013, GO:0040012, GO:2000026, GO:2000146, GO:0048523
GO:0048701 [BP]	embryonic cranial skeleton morphogenesis	probable	GO:0048598, GO:0048562, GO:0048568, GO:0009790, GO:0048706, GO:0009653, GO:0007275, GO:0044699, GO:0048513, GO:0043009, GO:0048705, GO:0048704, GO:0009887, GO:0032501, GO:0044767, GO:0008150, GO:0044707, GO:0001501, GO:0048856, GO:0032502, GO:0009792, GO:0048731
GO:0018105 [BP]	peptidyl-serine phosphorylation	probable	GO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0008354 [BP]	germ cell migration	probable	GO:0040011, GO:0044702, GO:0051674, GO:0048609, GO:0032504, GO:0048870, GO:0032501, GO:0009987, GO:0019953, GO:0006928, GO:0022414, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0016477, GO:0051179, GO:0007276, GO:0000003
GO:0035162 [BP]	embryonic hemopoiesis	probable	GO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048568, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0005923 [CC]	tight junction	probable	GO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0007181 [BP]	transforming growth factor beta receptor complex assembly	probable	GO:0022607, GO:0070887, GO:0070271, GO:0043933, GO:0034622, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0071840, GO:0009719, GO:0051716, GO:0071822, GO:0070848, GO:0016043, GO:0065003, GO:0071310, GO:0065007, GO:0044699, GO:0071559, GO:0071495, GO:0009987, GO:0006461, GO:0050794, GO:0042221, GO:0008150, GO:0007154, GO:0043623, GO:0010033, GO:0007179, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0044085, GO:0044763
GO:0031396 [BP]	regulation of protein ubiquitination	probable	GO:0032268, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0065007, GO:0031399, GO:0008150, GO:0050789
GO:0043627 [BP]	response to estrogen stimulus	probable	GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0032926 [BP]	negative regulation of activin receptor signaling pathway	probable	GO:0090092, GO:0032925, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0001822 [BP]	kidney development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0007275, GO:0044699
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0043542 [BP]	endothelial cell migration	probable	GO:0040011, GO:0032501, GO:0010631, GO:0044707, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0051179, GO:0008150, GO:0001667, GO:0016477, GO:0090132, GO:0044699, GO:0090130
GO:0006917 [BP]	induction of apoptosis	probable	GO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0060836 [BP]	lymphatic endothelial cell differentiation	probable	GO:0030154, GO:0072359, GO:0072358, GO:0045446, GO:0007275, GO:0044699, GO:0003158, GO:0001944, GO:0001945, GO:0030855, GO:0032502, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0048869, GO:0008150, GO:0009987
GO:0043393 [BP]	regulation of protein binding	probable	GO:0008150, GO:0065009, GO:0051098, GO:0065007
GO:0071773 [BP]	cellular response to BMP stimulus	probable	GO:0071495, GO:0009719, GO:0051716, GO:0071363, GO:0050896, GO:0009987, GO:0044763, GO:0070848, GO:0071310, GO:0008150, GO:0044699, GO:0070887, GO:0042221, GO:0010033, GO:0071772
GO:0005901 [CC]	caveola	probable	GO:0045121, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0000186 [BP]	activation of MAPKK activity	probable	GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048583, GO:0032147, GO:0023051, GO:0010646, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0051347, GO:0010604, GO:0009966, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0048844 [BP]	artery morphogenesis	probable	GO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0008150, GO:0048731, GO:0009653, GO:0060840, GO:0007275, GO:0044699
GO:0048538 [BP]	thymus development	probable	GO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0048663 [BP]	neuron fate commitment	probable	GO:0032502, GO:0048699, GO:0045165, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0032501, GO:0044763, GO:0048731, GO:0044707, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0001755 [BP]	neural crest cell migration	probable	GO:0030154, GO:0048468, GO:0006928, GO:0051674, GO:0001667, GO:0007275, GO:0044699, GO:0014032, GO:0014033, GO:0014031, GO:0048864, GO:0048869, GO:0048513, GO:0016477, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0044763, GO:0048731, GO:0060485, GO:0051179, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0008150
GO:2000279 [BP]	negative regulation of DNA biosynthetic process	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0050789, GO:0045934, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0051053, GO:0051052, GO:0019219, GO:2000278, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:0010556, GO:0010558, GO:0048523
GO:0001889 [BP]	liver development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0061008, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0035462 [BP]	determination of left/right asymmetry in diencephalon	probable	GO:0032502, GO:0021536, GO:0044707, GO:0007420, GO:0007399, GO:0007389, GO:0032501, GO:0007368, GO:0048856, GO:0044767, GO:0048513, GO:0030900, GO:0008150, GO:0035545, GO:0009855, GO:0009799, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0000082 [BP]	G1/S transition of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0030307 [BP]	positive regulation of cell growth	probable	GO:0045927, GO:0040008, GO:0051128, GO:0001558, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0031290 [BP]	retinal ganglion cell axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0001569 [BP]	patterning of blood vessels	probable	GO:0048754, GO:0072359, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001525, GO:0001568, GO:0001944, GO:0048514, GO:0048729, GO:0060562, GO:0048646, GO:0032502, GO:0032501, GO:0035239, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0044707, GO:0048856, GO:0072358, GO:0048731, GO:0002009
GO:0060923 [BP]	cardiac muscle cell fate commitment	probable	GO:0030154, GO:0072359, GO:0072358, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0060911, GO:0048869, GO:0008150, GO:0048513, GO:0032502, GO:0032501, GO:0055007, GO:0009987, GO:0035051, GO:0009888, GO:0044767, GO:0044763, GO:0007507, GO:0045165, GO:0044707, GO:0048856, GO:0014706, GO:0048738, GO:0060537, GO:0048731, GO:0042693, GO:0042692
GO:0001946 [BP]	lymphangiogenesis	probable	GO:0032502, GO:0036303, GO:0044707, GO:0032501, GO:0048856, GO:0001944, GO:0001945, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0001947 [BP]	heart looping	probable	GO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009799, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007368, GO:0048513, GO:0048729, GO:0060562, GO:0061371, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0007507, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0007389, GO:0008150, GO:0035295, GO:0003143, GO:0044707, GO:0048856, GO:0044767, GO:0009855, GO:0048731
GO:0060037 [BP]	pharyngeal system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048731, GO:0043009, GO:0007275, GO:0044699
GO:0060030 [BP]	dorsal convergence	probable	GO:0032502, GO:0060026, GO:0042074, GO:0006928, GO:0009790, GO:0051674, GO:0001667, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007369, GO:0048729, GO:0060027, GO:0016477, GO:0048598, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0051179, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0044763, GO:0009987
GO:0071385 [BP]	cellular response to glucocorticoid stimulus	probable	GO:0051384, GO:0071383, GO:0071384, GO:0070887, GO:0044699, GO:0009719, GO:0051716, GO:0033993, GO:0071310, GO:0014070, GO:0071495, GO:0031960, GO:0009987, GO:0071396, GO:0032870, GO:0008150, GO:0042221, GO:0010033, GO:0009725, GO:0050896, GO:0071407, GO:0044763, GO:0048545
GO:0038100 [MF]	nodal binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:1901383 [BP]	negative regulation of chorionic trophoblast cell proliferation	probable	GO:0042127, GO:0008285, GO:0050794, GO:0008150, GO:0065007, GO:1901382, GO:0048519, GO:0050789, GO:0048523
GO:0061445 [BP]	endocardial cushion cell fate commitment	probable	GO:0030154, GO:0003348, GO:0072359, GO:0072358, GO:0060956, GO:0060957, GO:0045446, GO:0007275, GO:0044699, GO:0060911, GO:0003157, GO:0048869, GO:0008150, GO:0003197, GO:0048513, GO:0030855, GO:0060839, GO:0032502, GO:0009987, GO:0061443, GO:0032501, GO:0060429, GO:0035051, GO:0009888, GO:0044767, GO:0044763, GO:0072148, GO:0060485, GO:0007507, GO:0045165, GO:0044707, GO:0048856, GO:0003158, GO:0048731
GO:0003140 [BP]	determination of left/right asymmetry in lateral mesoderm	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0007498, GO:0007368, GO:0048856, GO:0009888, GO:0008150, GO:0009855, GO:0009799, GO:0007275, GO:0044699, GO:0048368
GO:0003146 [BP]	heart jogging	probable	GO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009799, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007368, GO:0048513, GO:0048729, GO:0060562, GO:0061371, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0007507, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0007389, GO:0008150, GO:0035295, GO:0003143, GO:0044707, GO:0048856, GO:0044767, GO:0009855, GO:0048731
GO:0051897 [BP]	positive regulation of protein kinase B signaling cascade	probable	GO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0050789, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0051896, GO:0048522
GO:0051895 [BP]	negative regulation of focal adhesion assembly	probable	GO:0030155, GO:0051129, GO:0051128, GO:0007162, GO:0051893, GO:0050789, GO:0044699, GO:0090109, GO:0065007, GO:0048519, GO:1901889, GO:1901888, GO:0010810, GO:0010812, GO:0009987, GO:0050794, GO:0044763, GO:0001953, GO:0001952, GO:0044087, GO:0008150, GO:0048523
GO:0060317 [BP]	cardiac epithelial to mesenchymal transition	probable	GO:0048863, GO:0030154, GO:0048468, GO:0072359, GO:0072358, GO:0009653, GO:0007275, GO:0044699, GO:0014031, GO:0048864, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0048513, GO:0071840, GO:0032502, GO:0048762, GO:0009887, GO:0032501, GO:0009987, GO:0009888, GO:0003007, GO:0000904, GO:0008150, GO:0060485, GO:0007507, GO:0044707, GO:0048856, GO:0044763, GO:0001837, GO:0044767, GO:0048731
GO:0061154 [BP]	endothelial tube morphogenesis	probable	GO:0032502, GO:0002009, GO:0048856, GO:0035239, GO:0044707, GO:0003159, GO:0003158, GO:0060429, GO:0009888, GO:0044767, GO:0032501, GO:0008150, GO:0048729, GO:0060562, GO:0035295, GO:0009653, GO:0007275, GO:0044699
GO:0035313 [BP]	wound healing, spreading of epidermal cells	probable	GO:0048856, GO:0006928, GO:0051674, GO:0009653, GO:0044699, GO:0002009, GO:0009611, GO:0048729, GO:0016477, GO:0032502, GO:0009987, GO:0060429, GO:0009888, GO:0042060, GO:0044767, GO:0006950, GO:0044763, GO:0051179, GO:0040011, GO:0090504, GO:0090505, GO:0050896, GO:0048870, GO:0002011, GO:0044319, GO:0008150
GO:0060017 [BP]	parathyroid gland development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0035270, GO:0048513, GO:0008150, GO:0048731, GO:0048732, GO:0007275, GO:0044699
GO:0007493 [BP]	endodermal cell fate determination	probable	GO:0048598, GO:0007492, GO:0007369, GO:0030154, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0001706, GO:0001704, GO:0048869, GO:0001709, GO:0048646, GO:0032502, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0035987, GO:0001711, GO:0045165, GO:0044707, GO:0048856, GO:0060795, GO:0008150
GO:0001550 [BP]	ovarian cumulus expansion	probable	GO:0022605, GO:0022602, GO:0061458, GO:0019953, GO:0008585, GO:0048165, GO:0048608, GO:0048589, GO:0007275, GO:0044699, GO:0001547, GO:0001541, GO:0008406, GO:0045137, GO:0048511, GO:0048513, GO:0007276, GO:0048477, GO:0032502, GO:0032501, GO:0046545, GO:0048609, GO:0032504, GO:0044767, GO:0022414, GO:0008150, GO:0040007, GO:0046660, GO:0000003, GO:0007292, GO:0007548, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0042698, GO:0048731
GO:0008217 [BP]	regulation of blood pressure	probable	GO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0065007, GO:0065008, GO:0044699, GO:0003008
GO:0070700 [MF]	BMP receptor binding	probable	GO:0033612, GO:0003674, GO:0005488, GO:0005515, GO:0005102, GO:0070696
GO:0010694 [BP]	positive regulation of alkaline phosphatase activity	probable	GO:0051336, GO:0019220, GO:0019222, GO:0051345, GO:0010921, GO:0010922, GO:0050790, GO:0031323, GO:0050789, GO:0051174, GO:0065007, GO:0044093, GO:0010692, GO:0008150, GO:0035303, GO:0050794, GO:0065009, GO:0043085
GO:0051145 [BP]	smooth muscle cell differentiation	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699
GO:0001702 [BP]	gastrulation with mouth forming second	probable	GO:0048598, GO:0032502, GO:0048856, GO:0044707, GO:0007369, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0003342 [BP]	proepicardium development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0048513, GO:0008150, GO:0048731, GO:0060485, GO:0003343, GO:0007275, GO:0044699
GO:0032331 [BP]	negative regulation of chondrocyte differentiation	probable	GO:0051093, GO:0045596, GO:0050793, GO:0065007, GO:0050794, GO:0008150, GO:0032330, GO:0045595, GO:0061035, GO:2000026, GO:0051239, GO:0048519, GO:0050789, GO:0048523
GO:0019901 [MF]	protein kinase binding	probable	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0001974 [BP]	blood vessel remodeling	probable	GO:0044699, GO:0032501, GO:0008150, GO:0048771, GO:0044707
GO:0070723 [BP]	response to cholesterol	probable	GO:1901700, GO:0033993, GO:0050896, GO:0008150, GO:0042221, GO:0036314, GO:0097305, GO:0010033, GO:0014070
GO:0038092 [BP]	nodal signaling pathway	probable	GO:0044700, GO:0051716, GO:0032924, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699, GO:0007178
GO:0030308 [BP]	negative regulation of cell growth	probable	GO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0042475 [BP]	odontogenesis of dentin-containing tooth	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0042476, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0001502 [BP]	cartilage condensation	probable	GO:0032502, GO:0016337, GO:0001501, GO:0009653, GO:0007275, GO:0044699, GO:0048513, GO:0022610, GO:0048705, GO:0009887, GO:0032501, GO:0009987, GO:0009888, GO:0061448, GO:0044767, GO:0044763, GO:0048731, GO:0007155, GO:0051216, GO:0044707, GO:0048856, GO:0008150
GO:0002526 [BP]	acute inflammatory response	probable	GO:0050896, GO:0009611, GO:0006952, GO:0006950, GO:0008150, GO:0006954
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0061298 [BP]	retina vasculature development in camera-type eye	probable	GO:0032502, GO:0048513, GO:0032501, GO:0044767, GO:0007423, GO:0044707, GO:0048856, GO:0001944, GO:0008150, GO:0072359, GO:0072358, GO:0001654, GO:0060041, GO:0048731, GO:0043010, GO:0007275, GO:0044699
GO:0035124 [BP]	embryonic caudal fin morphogenesis	probable	GO:0048598, GO:0033333, GO:0044707, GO:0033336, GO:0035141, GO:0033334, GO:0032501, GO:0033338, GO:0048856, GO:0035107, GO:0044767, GO:0009790, GO:0035122, GO:0008150, GO:0044699, GO:0035113, GO:0035143, GO:0009653, GO:0032502, GO:0007275, GO:0048736
GO:0002088 [BP]	lens development in camera-type eye	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0043537 [BP]	negative regulation of blood vessel endothelial cell migration	probable	GO:0030336, GO:0040013, GO:0030334, GO:0010594, GO:0010632, GO:0010633, GO:0010596, GO:0051271, GO:0040012, GO:0065007, GO:0043535, GO:0051270, GO:2000145, GO:0008150, GO:0051239, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0003289 [BP]	atrial septum primum morphogenesis	probable	GO:0003284, GO:0003283, GO:0072359, GO:0072358, GO:0009653, GO:0007275, GO:0044699, GO:0003205, GO:0003206, GO:0003209, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0003007, GO:0008150, GO:0003230, GO:0007507, GO:0003279, GO:0044707, GO:0048856, GO:0044767, GO:0060413, GO:0048731, GO:0060411
GO:0021556 [BP]	central nervous system formation	probable	GO:0032502, GO:0021551, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0008150, GO:0044699, GO:0048731, GO:0009653, GO:0007275, GO:0048646, GO:0007417
GO:0060391 [BP]	positive regulation of SMAD protein import into nucleus	probable	GO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0048584, GO:0048583, GO:0070201, GO:0023056, GO:0023051, GO:0010647, GO:0010646, GO:0051222, GO:0032880, GO:0051223, GO:0090100, GO:0009966, GO:0009967, GO:0050789, GO:0065007, GO:0048518, GO:0090092, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:1900180, GO:0060390, GO:0046824, GO:0046822, GO:0048522
GO:0003183 [BP]	mitral valve morphogenesis	probable	GO:0032502, GO:0007507, GO:0003170, GO:0044707, GO:0048513, GO:0032501, GO:0048856, GO:0072359, GO:0044767, GO:0003179, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0003174
GO:0035108 [BP]	limb morphogenesis	probable	GO:0032502, GO:0048856, GO:0044707, GO:0060173, GO:0035107, GO:0044767, GO:0032501, GO:0008150, GO:0044699, GO:0009653, GO:0007275, GO:0048736
GO:0043280 [BP]	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	probable	GO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0030513 [BP]	positive regulation of BMP signaling pathway	probable	GO:0090092, GO:0010646, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0050789, GO:0030510
GO:0030199 [BP]	collagen fibril organization	probable	GO:0009987, GO:0016043, GO:0030198, GO:0044763, GO:0071840, GO:0043062, GO:0008150, GO:0044699
GO:0010718 [BP]	positive regulation of epithelial to mesenchymal transition	probable	GO:0022604, GO:2000736, GO:0022603, GO:0051128, GO:0050789, GO:0060284, GO:0010769, GO:0065007, GO:0010720, GO:0048518, GO:0051130, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0051094, GO:0010717, GO:2000026, GO:0010770, GO:0048522
GO:0070411 [MF]	I-SMAD binding	probable	GO:0046332, GO:0003674, GO:0005488, GO:0005515
GO:0060841 [BP]	venous blood vessel development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:1901165 [BP]	positive regulation of trophoblast cell migration	probable	GO:2000243, GO:2000241, GO:0050789, GO:0065007, GO:0048518, GO:2000145, GO:1901163, GO:0030335, GO:0030334, GO:0050793, GO:0050794, GO:0043900, GO:0051270, GO:0008150, GO:0051239, GO:0032879, GO:0051272, GO:0040012, GO:0040017, GO:2000026, GO:2000147, GO:0048522
GO:0031101 [BP]	fin regeneration	probable	GO:0048589, GO:0035107, GO:0009653, GO:0007275, GO:0044699, GO:0040007, GO:0031099, GO:0009611, GO:0032502, GO:0033333, GO:0032501, GO:0033334, GO:0009888, GO:0042060, GO:0044767, GO:0006950, GO:0008150, GO:0044707, GO:0050896, GO:0048856, GO:0042246, GO:0048736
GO:0031100 [BP]	organ regeneration	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0031099, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0048565 [BP]	digestive tract development	probable	GO:0032502, GO:0055123, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001834 [BP]	trophectodermal cell proliferation	probable	GO:0032502, GO:0032501, GO:0044707, GO:0001701, GO:0040007, GO:0048589, GO:0008283, GO:0001832, GO:0001824, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699, GO:0048856
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030718 [BP]	germ-line stem cell maintenance	probable	GO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0019827, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0031625 [MF]	ubiquitin protein ligase binding	probable	GO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0009749 [BP]	response to glucose stimulus	probable	GO:0009746, GO:1901700, GO:0009743, GO:0034284, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0032927 [BP]	positive regulation of activin receptor signaling pathway	probable	GO:0090092, GO:0032925, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0034711 [MF]	inhibin binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0030324 [BP]	lung development	probable	GO:0060541, GO:0032502, GO:0030323, GO:0044707, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0007275, GO:0044699
GO:0005114 [MF]	type II transforming growth factor beta receptor binding	probable	GO:0005126, GO:0005160, GO:0003674, GO:0005488, GO:0005515, GO:0005102
GO:0045648 [BP]	positive regulation of erythrocyte differentiation	probable	GO:0051094, GO:0050793, GO:0045646, GO:0065007, GO:0032844, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0050794, GO:0045637, GO:0048522
GO:0000981 [MF]	sequence-specific DNA binding RNA polymerase II transcription factor activity	probable	GO:0003700, GO:0003674, GO:0001071
GO:0002021 [BP]	response to dietary excess	probable	GO:0032501, GO:0040014, GO:0044707, GO:0050896, GO:0050789, GO:0008150, GO:0051239, GO:0065007, GO:0040008, GO:0044699
GO:0048263 [BP]	determination of dorsal identity	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009953, GO:0044707, GO:0009799, GO:0008150, GO:0003002, GO:0009855, GO:0048262, GO:0007275, GO:0044699
GO:0048264 [BP]	determination of ventral identity	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009953, GO:0044707, GO:0009799, GO:0008150, GO:0003002, GO:0009855, GO:0048262, GO:0007275, GO:0044699
GO:0017046 [MF]	peptide hormone binding	probable	GO:0033218, GO:0003674, GO:0042277, GO:0042562, GO:0005488
GO:0060021 [BP]	palate development	probable	GO:0032502, GO:0048856, GO:0008150
GO:0009636 [BP]	response to toxic substance	probable	GO:0042221, GO:0050896, GO:0008150
GO:0010629 [BP]	negative regulation of gene expression	probable	GO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0001955 [BP]	blood vessel maturation	probable	GO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0044699, GO:0048731, GO:0010259, GO:0007275, GO:0071695
GO:0007304 [BP]	chorion-containing eggshell formation	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0009653, GO:0044699, GO:0000003, GO:0030703, GO:0030707, GO:0007276, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0044763, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0048869, GO:0008150
GO:0032868 [BP]	response to insulin stimulus	probable	GO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0043434, GO:0010033
GO:0007015 [BP]	actin filament organization	probable	GO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0034695 [BP]	response to prostaglandin E stimulus	probable	GO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0070542, GO:0008150, GO:0034694, GO:0033993, GO:0042221, GO:0010033
GO:0006275 [BP]	regulation of DNA replication	probable	GO:0009889, GO:0051052, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0050794, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:0008150, GO:0050789, GO:0080090
GO:0009411 [BP]	response to UV	probable	GO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0060971 [BP]	embryonic heart tube left/right pattern formation	probable	GO:0032502, GO:0007507, GO:0072359, GO:0032501, GO:0044707, GO:0007389, GO:0048513, GO:0048856, GO:0035050, GO:0044767, GO:0009790, GO:0060972, GO:0072358, GO:0008150, GO:0003002, GO:0048731, GO:0035295, GO:0007275, GO:0044699
GO:0007476 [BP]	imaginal disc-derived wing morphogenesis	probable	GO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0019915 [BP]	lipid storage	probable	GO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0042493 [BP]	response to drug	probable	GO:0042221, GO:0050896, GO:0008150
GO:0030901 [BP]	midbrain development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0032332 [BP]	positive regulation of chondrocyte differentiation	probable	GO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0032330, GO:0045595, GO:0061035, GO:2000026, GO:0008150, GO:0051239, GO:0048518, GO:0065007, GO:0050789, GO:0048522
GO:0051602 [BP]	response to electrical stimulus	probable	GO:0009628, GO:0050896, GO:0008150
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0035222 [BP]	wing disc pattern formation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0007447, GO:0044707, GO:0007444, GO:0048856, GO:0035220, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699
GO:0007448 [BP]	anterior/posterior pattern specification, imaginal disc	probable	GO:0032502, GO:0007389, GO:0032501, GO:0007447, GO:0009952, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699
GO:0007050 [BP]	cell cycle arrest	probable	GO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0021549 [BP]	cerebellum development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0022037, GO:0044767, GO:0048513, GO:0008150, GO:0030902, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0042078 [BP]	germ-line stem cell division	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0008356, GO:0051301, GO:0000003, GO:0048869, GO:0007276, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0044763, GO:0022412, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0017145
GO:0021766 [BP]	hippocampus development	probable	GO:0032502, GO:0021537, GO:0032501, GO:0007420, GO:0044707, GO:0048856, GO:0007399, GO:0044767, GO:0021543, GO:0048513, GO:0030900, GO:0008150, GO:0021761, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0045887 [BP]	positive regulation of synaptic growth at neuromuscular junction	probable	GO:0048639, GO:0048638, GO:0019226, GO:0045927, GO:0035637, GO:0050803, GO:0008582, GO:0050807, GO:0048634, GO:0051128, GO:0032501, GO:0023052, GO:0051147, GO:0050789, GO:0044699, GO:0051962, GO:0040008, GO:0060284, GO:0065007, GO:0048518, GO:0048641, GO:0065008, GO:0051130, GO:0016202, GO:0009987, GO:0050793, GO:0050877, GO:0048742, GO:1901861, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051094, GO:0051963, GO:0044087, GO:0051960, GO:2000026, GO:0051965, GO:0044763, GO:0044089, GO:0048522
GO:0006703 [BP]	estrogen biosynthetic process	probable	GO:0044249, GO:0008210, GO:1901362, GO:1901360, GO:0042445, GO:0042446, GO:0071704, GO:0065007, GO:0065008, GO:0006629, GO:1901576, GO:0009987, GO:0044710, GO:0010817, GO:0009058, GO:0008150, GO:0008152, GO:0034754, GO:0008202, GO:0008610, GO:0044238, GO:0044237, GO:0006694
GO:0001666 [BP]	response to hypoxia	probable	GO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0005771 [CC]	multivesicular body	probable	GO:0005737, GO:0043231, GO:0043227, GO:0005770, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0007300 [BP]	ovarian nurse cell to oocyte transport	probable	GO:0044702, GO:0048609, GO:0032504, GO:0006810, GO:0019953, GO:0007292, GO:0022414, GO:0044765, GO:0032501, GO:0008150, GO:0044699, GO:0051234, GO:0048477, GO:0051179, GO:0007276, GO:0000003
GO:0030514 [BP]	negative regulation of BMP signaling pathway	probable	GO:0090092, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0030510
GO:0030512 [BP]	negative regulation of transforming growth factor beta receptor signaling pathway	probable	GO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0046676 [BP]	negative regulation of insulin secretion	probable	GO:0090087, GO:0051046, GO:0051048, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048519, GO:0051051, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046888, GO:0032879, GO:0090278, GO:0002791, GO:0002792, GO:0048523
GO:0002043 [BP]	blood vessel endothelial cell proliferation involved in sprouting angiogenesis	probable	GO:0032502, GO:0032501, GO:0009653, GO:0044707, GO:0008283, GO:0001935, GO:0001568, GO:0048856, GO:0001944, GO:0050673, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0044699, GO:0048731, GO:0008150, GO:0001525, GO:0002040, GO:0007275, GO:0048646
GO:0007566 [BP]	embryo implantation	probable	GO:0032502, GO:0044703, GO:0044702, GO:0000003, GO:0044707, GO:0044706, GO:0007565, GO:0022414, GO:0032501, GO:0008150, GO:0007275, GO:0044699, GO:0051704

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.30	2.7.11.30 and 2.7.12.1.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B6C, chain B
Confidence level:very confident
Coverage over the Query: 109-432
View the alignment between query and template
View the model in PyMOL

Template: 2L2T, chain A
Confidence level:probable
Coverage over the Query: 47-79
View the alignment between query and template
View the model in PyMOL

Template: 4FAO, chain E
Confidence level:probable
Coverage over the Query: 10-30
View the alignment between query and template
View the model in PyMOL