Diaphorina citri psyllid: psy14895


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MSTPIEELCKGYPGEFPTFLLYSRSLRFEEKPDYSYTRQLFRNLFHRKGFTYDYVFDWNMLKFGGSRGPAGAQPVGRKIKSYDYVFDWNMLKFGGSRGPAGAQPVAGDTPTNPPGVDAPPASRTRAGGTNGEGESPQHPPTKSYHSPAVISSNNKPVPNIVPRVLAPNAASRPFVDYRGSGGGEERGGGGGDSSRMWKKPIIPPPVPEPENKFYFPPSAPNAASRPFVDYRGSGGGEERGGGGGDSSRMWKKPIIPPPVPEPENKLGKVTVFKRVV
ccccHHHHcccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcc
*STPIEELCKGYPGEFPTFLLYSRSLRFEEKPDYSYTRQLFRNLFHRKGFTYDYVFDWNMLKFGGS*******************************************************************************************************************************************************************************************************LGKVTVFKRVV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTPIEELCKGYPGEFPTFLLYSRSLRFEEKPDYSYTRQLFRNLFHRKGFTYDYVFDWNMLKFGGSRGPAGAQPVGRKIKSYDYVFDWNMLKFGGSRGPAGAQPVAGDTPTNPPGVDAPPASRTRAGGTNGEGESPQHPPTKSYHSPAVISSNNKPVPNIVPRVLAPNAASRPFVDYRGSGGGEERGGGGGDSSRMWKKPIIPPPVPEPENKFYFPPSAPNAASRPFVDYRGSGGGEERGGGGGDSSRMWKKPIIPPPVPEPENKLGKVTVFKRVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0090263 [BP]positive regulation of canonical Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0001948 [MF]glycoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051225 [BP]spindle assemblyprobableGO:0006996, GO:0022607, GO:0007010, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0044763, GO:0016043, GO:0065003, GO:0007051, GO:0044085, GO:0000226, GO:0044699, GO:0008150, GO:0022402, GO:0009987, GO:0070925, GO:0007049, GO:0007017
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0042277 [MF]peptide bindingprobableGO:0033218, GO:0003674, GO:0005488
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004672 [MF]protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0051219 [MF]phosphoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SV0, chain A
Confidence level:confident
Coverage over the Query: 3-63
View the alignment between query and template
View the model in PyMOL