Diaphorina citri psyllid: psy14896


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810---
MSLISSCLFIFVSFHSVFSQTIDELELRCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWVNEDGTNLNELDAAFLPEPADNVQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEASIQKLHYLLNDDRTYQYGMDIENPDKIPRGPYFIKQPTDVVFDLSKRSILNDITLSCYAGGYPNPSYEWFKEDYVQDRLVANLIDPLSDKRFTLSGGNLIINDPRQVEDRGSYHCKASNKFGSIISESVQLAFGFIGEFNLKRAPEIGNQNWGKAMFCDPPTNYPGVNYYWARDYFPNFVEEDKRVFVSYDGALYFSALEQIDAGNYSCNVQSKVSDTGRNGPFFPLKVFPHSNFQQLKFPNNFPKTFPEAPKAGDKVRLECVAFGYPVPSYNWTRRGSPLPRNAYFENFNRILTIPNVKMRGPYFIKQPTDVVFDLSKRSILNDITLSCYAGGYPNPSYEWFKEDYVQDRLVANLIDPLSDKRFTLSGGNLIINDPRQVEDRGSYHCKASNKFGSIISESVQLAFGFIGEFNLKRAPEIGNQNWGKAMFCDPPTNYPGVNYYWARDYFPNFVEEDKRVFVSYDGALYFSALEQIDAGNYSCNVQSKVSDTGRNGPFFPLKVFPHSNFQQLKFPNNFPKTFPEAPKAGDKVRLECVAFGYPVPSYNWTRRGSPLPRNAYFENFNRILTIPNVKVEDQGEYICRASNDRSALESSVTISIQAEPNFTIPLTDKHMDNQADLTWTCEAFGVPDVTYSWFRNGELGHQMTDLLLKAV
ccccCEEEEEEEEccccEEEEcccccccccccEEEEccEEEEEEccccCEcccccccccEEEEEEEECcccccEEEEEEEEECccccccEEEEEEEECcccEEEcccccEEEEEEEECcccccEEEEEccEEEEEEcccEEEEEECccccccEEEEEEEEEEEEcEEccccCEEEEEEEEccccccccccEEECcccCEEEEcccccccccEEEEEEEEECcccEEEEEEccEEccccccEEcccccccEEEEEccEEEEEccccccccEEEEEEEEEccEEEEEEEEEEEEEEccccccccccEEEEccccEEEEccccccccccEEEEEEccccccccccccEEEccccEEEEccccccccCEEEEEEEEcccccCECcccEEEEECcccccccccccccccccccccccccccEEEEEEEEECcccEEEEEEcccccccccEEECcccEEEEccccccccEEEECcccCECcccCECccccEEEEEEEEECcccEEEEEEccEEcccccccccccccccEEEEEccEEEEEccccccccCEEEEEEEEcccEEEEEEEEEEEEEccccccccccEEEEccccEEEEEcccccccccEEEEEEccEEccccccccEEEcccccEEEccccccccEEEEEEEEEccccccccccEEEEECccccccccccccccccccccccccccccEEEEEEEECccccEEEEEEccEEcccccEEEECccEEEEccccccccCEEEEEEEEccccCEEEEEEEEEccccccccccEEEEcccccEEEEEEEEECcccEEEEEEccEEccccccEEEEEc
**LISSCLFIFVSFHSVFSQTIDELELRCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWVNEDGTNLNELDAAFLPEPADNVQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEASIQKLHYLLNDDRTYQYGMDIENPDKIPRGPYFIKQPTDVVFDLSKRSILNDITLSCYAGGYPNPSYEWFKEDYVQDRLVANLIDPLSDKRFTLSGGNLIINDPRQVEDRGSYHCKASNKFGSIISESVQLAFGFIGEFNLKRAPEIGNQNWGKAMFCDPPTNYPGVNYYWARDYFPNFVEEDKRVFVSYDGALYFSALEQIDAGNYSCNVQSKVSDTGRNGPFFPLKVFPHSNFQQLKFPNNFPKTFP**PKAGDKVRLECVAFGYPVPSYNWTRRGSPLPRNAYFENFNRILTIPNVKMRGPYFIKQPTDVVFDLSKRSILNDITLSCYAGGYPNPSYEWFKEDYVQDRLVANLIDPLSDKRFTLSGGNLIINDPRQVEDRGSYHCKASNKFGSIISESVQLAFGFIGEFNLKRAPEIGNQNWGKAMFCDPPTNYPGVNYYWARDYFPNFVEEDKRVFVSYDGALYFSALEQIDAGNYSCNVQSKVSDTGRNGPFFPLKVFPHSNFQQLKFPNNFPKTFPEAPKAGDKVRLECVAFGYPVPSYNWTRRGSPLPRNAYFENFNRILTIPNVKVEDQGEYICRASNDRSALESSVTISIQAEPNFTIPLTDKHMDNQADLTWTCEAFGVPDVTYSWFRNGELGHQMTDLLLKAV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLISSCLFIFVSFHSVFSQTIDELELRCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWVNEDGTNLNELDAAFLPEPADNVQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEASIQKLHYLLNDDRTYQYGMDIENPDKIPRGPYFIKQPTDVVFDLSKRSILNDITLSCYAGGYPNPSYEWFKEDYVQDRLVANLIDPLSDKRFTLSGGNLIINDPRQVEDRGSYHCKASNKFGSIISESVQLAFGFIGEFNLKRAPEIGNQNWGKAMFCDPPTNYPGVNYYWARDYFPNFVEEDKRVFVSYDGALYFSALEQIDAGNYSCNVQSKVSDTGRNGPFFPLKVFPHSNFQQLKFPNNFPKTFPEAPKAGDKVRLECVAFGYPVPSYNWTRRGSPLPRNAYFENFNRILTIPNVKMRGPYFIKQPTDVVFDLSKRSILNDITLSCYAGGYPNPSYEWFKEDYVQDRLVANLIDPLSDKRFTLSGGNLIINDPRQVEDRGSYHCKASNKFGSIISESVQLAFGFIGEFNLKRAPEIGNQNWGKAMFCDPPTNYPGVNYYWARDYFPNFVEEDKRVFVSYDGALYFSALEQIDAGNYSCNVQSKVSDTGRNGPFFPLKVFPHSNFQQLKFPNNFPKTFPEAPKAGDKVRLECVAFGYPVPSYNWTRRGSPLPRNAYFENFNRILTIPNVKVEDQGEYICRASNDRSALESSVTISIQAEPNFTIPLTDKHMDNQADLTWTCEAFGVPDVTYSWFRNGELGHQMTDLLLKAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WIM, chain A
Confidence level:very confident
Coverage over the Query: 189-236,247-446,523-565
View the alignment between query and template
View the model in PyMOL
Template: 2WIM, chain A
Confidence level:very confident
Coverage over the Query: 480-509,520-758
View the alignment between query and template
View the model in PyMOL
Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 187-510,521-802
View the alignment between query and template
View the model in PyMOL
Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 141-761
View the alignment between query and template
View the model in PyMOL
Template: 2XR6, chain A
Confidence level:very confident
Coverage over the Query: 28-161
View the alignment between query and template
View the model in PyMOL
Template: 2V5S, chain A
Confidence level:probable
Coverage over the Query: 461-654,665-813
View the alignment between query and template
View the model in PyMOL