Diaphorina citri psyllid: psy1489

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23

NISTTGPKLKEVPKGKDHSSHLWLKRQFADPYVQKAKKENYRCRSAFKLLEIDSKIKFLRPGLKVLDCGAAPGSWSQVAVKLVNSHGYDSKQPKGLVLSVDKLPIYPIDGAVVLSKCDFTQPDIQDRLVTILKDDKLDVVLSDMAPNATGMREMDHDLITQLAIAVIRFAVTYSKPGADCLIKIWDGRNRPQLEESITRFYSQVKILKPPSSRSHSAELFLLGRGFKGK

ccccccccccccccccccccHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHccccccccEEEECccccccHHHHHHHHHHcccccccccccEEEEEEccccccccccEEEEccccccHHHHHHHHHHHccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEcccccccccccEEEEEEcccccc

********************HLWLKRQFADPYVQKAKKENYRCRSAFKLLEIDSKIKFLRPGLKVLDCGAAPGSWSQVAVKLVNSHGYDSKQPKGLVLSVDKLPIYPIDGAVVLSKCDFTQPDIQDRLVTILKDDKLDVVLSDMAPNATGMREMDHDLITQLAIAVIRFAVTYSKPGADCLIKIWDGRNRPQLEESITRFYSQVKILKPPSSRSHSAELFLLGRGFKG*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Putative ribosomal RNA methyltransferase CG11447	Probable methyltransferase.	very confident	Q9VDT6
Ribosomal RNA large subunit methyltransferase E	Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit.	confident	A3PJK8
Ribosomal RNA large subunit methyltransferase E	Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit.	confident	A7IDJ5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008650 [MF]	rRNA (uridine-2'-O-)-methyltransferase activity	probable	GO:0008649, GO:0003824, GO:0008757, GO:0016436, GO:0008173, GO:0016740, GO:0008171, GO:0003674, GO:0008168, GO:0016741
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000453 [BP]	enzyme-directed rRNA 2'-O-methylation	probable	GO:0031167, GO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:0000451, GO:1901360, GO:0006139, GO:0044260, GO:0071840, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0032259, GO:0034470, GO:0009987, GO:0006725, GO:0043412, GO:0043414, GO:0008152, GO:0001510, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0000154, GO:0044237, GO:0043170, GO:0044085, GO:0008150, GO:0006396
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0030488 [BP]	tRNA methylation	probable	GO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0034470, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006400, GO:0032259, GO:0008033, GO:0009987, GO:0006725, GO:0043412, GO:0043414, GO:0008152, GO:0001510, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0006399, GO:0008150, GO:0006396

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.1.-.-	Transferring one-carbon groups.	probable
2.1.1.-	15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).	probable
2.1.1.166	23S rRNA (uridine(2552)-2'-O)-methyltransferase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NYU, chain A
Confidence level:very confident
Coverage over the Query: 40-228
View the alignment between query and template
View the model in PyMOL

Template: 3IV6, chain A
Confidence level:confident
Coverage over the Query: 18-83,95-187
View the alignment between query and template
View the model in PyMOL