Diaphorina citri psyllid: psy14914


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
VFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVREPGAAKYPSK
cCCcccccccccccccccEEEccccEEECcccEEEccccEEcccEEEEccccccccccccccccEEEccccccccccEEcccccccEEEEEcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHccEEEcccccccccccccccccc
*F**HH*EHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVR**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVREPGAAKYPSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004499 [MF]N,N-dimethylaniline monooxygenase activityprobableGO:0004497, GO:0016709, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XVE, chain A
Confidence level:very confident
Coverage over the Query: 1-208
View the alignment between query and template
View the model in PyMOL