Psyllid ID: psy14914

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
VFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVREPGAAKYPSK
cEEcccccccccccccccEEEccccEEEEcccEEEccccEEcccEEEEccccccccccccccccEEEccccccccccEEcccccccEEEEEcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHccEEEcccccccccccccccccc
cccccccccccccEccccEEEccccEEEccccEEEEcccEEEEEEEEEEcccEEEccccccccEEEEccccccccHHcccccccccEEEEEcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHccccccHHcccHHHHHcccccccccc
vflshhsehvkklrfpnnvvkkpdiaeltptgvrfqdgsyeqVDIILYCTgytyrypflhescgikvvnknvqPLYKHLIniehpsmciigipgdTVVFYMFDLQVRFFLQLMKGYvtlpskaemlaDTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASmmrgespvppvLLKIYFESFARRCEDFTAFRKDKYKIINekvfvrepgaakypsk
vflshhsehvkklrfpnnvvkkpdiaeltptgvrfqdgsyeQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRkesqsththvmhLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFrkdkykiinekvfvrepgaakypsk
VFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVREPGAAKYPSK
****************NNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLP************************************************VPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVR**********
VFLSHH*EHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVR**********
**********KKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIR************VMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVREPGAAKYPSK
*F**HHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVREPG*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVREPGAAKYPSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
Q8MP06456 Senecionine N-oxygenase O N/A N/A 0.921 0.436 0.301 1e-20
Q9FF12460 Flavin-containing monooxy yes N/A 0.546 0.256 0.375 2e-16
A8MRX0459 Flavin-containing monooxy no N/A 0.722 0.339 0.323 5e-16
Q9SXE1462 Flavin-containing monooxy no N/A 0.675 0.316 0.322 6e-16
Q95LA1532 Dimethylaniline monooxyge yes N/A 0.777 0.315 0.318 1e-15
Q9SS04459 Flavin-containing monooxy no N/A 0.694 0.326 0.333 4e-15
P97501534 Dimethylaniline monooxyge no N/A 0.699 0.282 0.341 7e-15
Q93Y23461 Flavin-containing monooxy no N/A 0.435 0.203 0.389 1e-14
Q94BV5452 Flavin-containing monooxy no N/A 0.578 0.276 0.340 2e-14
Q9FWW9465 Flavin-containing monooxy no N/A 0.449 0.208 0.397 2e-14
>sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 106/212 (50%), Gaps = 13/212 (6%)

Query: 6   HSEHVKKLR-------FPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPF 58
           HS+H+ K         FP N + KP++   T  G  F+D + E+ D+++YCTG+ Y +PF
Sbjct: 236 HSQHILKSWHIFNQPDFPGNFISKPNVKHFTANGAVFEDDTVEEFDMVIYCTGFYYNHPF 295

Query: 59  LHE-SCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYV 117
           L   S GI      V PLY+ ++NI  P+M  +GI        + D Q  +  +L  G+ 
Sbjct: 296 LSTLSSGITATENYVMPLYQQVVNINQPTMTFVGI-CKPFFAKLLDQQAHYSAKLAAGHF 354

Query: 118 TLPSKAEMLADTDQDIRAHRKESQSTHTHVMHL--RSEKYLNSLASMMRGESPVPPVLLK 175
            LPS+ +ML    + ++  R E+Q   T V  +    ++Y  +L     G   +PPV   
Sbjct: 355 KLPSQDKMLRHWLEHVQMLR-EAQFKITDVNSVGPNVDEYFKALHKEA-GVPLLPPVYAS 412

Query: 176 IYFESFARRCEDFTAFRKDKYKIINEKVFVRE 207
           ++  S     ED   +R+  Y+II++  F ++
Sbjct: 413 VFVFSGKTLLEDLQNYREYDYRIISDTQFKKK 444
NADPH-dependent monooxygenase that detoxifies senecionine and similar plant alkaloids that are ingested by the larvae. Is active towards a narrow range of related substrates with highest activity towards senecionine, followed by seneciphylline, retrorsine, monocrotaline, senecivernine, axillarine and axillaridine.
Tyria jacobaeae (taxid: 179666)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 0EC: 1
>sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 Back     alignment and function description
>sp|A8MRX0|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5 OS=Arabidopsis thaliana GN=FMOGS-OX5 PE=2 SV=2 Back     alignment and function description
>sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 Back     alignment and function description
>sp|Q95LA1|FMO3_CANFA Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis familiaris GN=FMO3 PE=2 SV=3 Back     alignment and function description
>sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 Back     alignment and function description
>sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 Back     alignment and function description
>sp|Q93Y23|GSOX4_ARATH Flavin-containing monooxygenase FMO GS-OX4 OS=Arabidopsis thaliana GN=FMOGS-OX4 PE=2 SV=1 Back     alignment and function description
>sp|Q94BV5|GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4 OS=Arabidopsis thaliana GN=At1g62600 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWW9|GSXL2_ARATH Flavin-containing monooxygenase FMO GS-OX-like 2 OS=Arabidopsis thaliana GN=At1g12200 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
193659748 444 PREDICTED: flavin-containing monooxygena 0.925 0.450 0.509 5e-52
193659750 448 PREDICTED: flavin-containing monooxygena 0.930 0.448 0.468 5e-47
380027061 419 PREDICTED: dimethylaniline monooxygenase 0.949 0.489 0.454 1e-45
66500583 419 PREDICTED: flavin-containing monooxygena 0.949 0.489 0.439 5e-44
91095259 417 PREDICTED: similar to dimethylaniline mo 0.949 0.491 0.432 1e-43
383864815 419 PREDICTED: flavin-containing monooxygena 0.949 0.489 0.434 2e-43
350425213 419 PREDICTED: flavin-containing monooxygena 0.949 0.489 0.429 7e-43
340709203 419 PREDICTED: flavin-containing monooxygena 0.949 0.489 0.429 8e-43
312371814 416 hypothetical protein AND_21611 [Anophele 0.939 0.487 0.422 5e-42
156537946 423 PREDICTED: flavin-containing monooxygena 0.949 0.484 0.427 2e-40
>gi|193659748|ref|XP_001946449.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 103/202 (50%), Positives = 142/202 (70%), Gaps = 2/202 (0%)

Query: 1   VFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLH 60
           V+LSHH++ VK ++FP+N+V+K DI E+   G+ FQDGSYEQVD ILYCTGY Y+YPFL 
Sbjct: 221 VYLSHHNQRVKNMKFPSNMVQKTDIKEVVENGIVFQDGSYEQVDSILYCTGYNYKYPFLS 280

Query: 61  ESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLP 120
             CGI+V N +V+PL+KH++NIEHP+M  IGIP +T  F M DLQV+F    ++G + LP
Sbjct: 281 PECGIRVENNHVKPLFKHVLNIEHPTMYFIGIPTNTAGFCMIDLQVQFAKTFLEGRMKLP 340

Query: 121 SKAEMLADTDQDIRAHRKES-QSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFE 179
           SK EM+ DT  D+        +    H+M  RS+ Y +SLAS+   ES V PV+L+IYF+
Sbjct: 341 SKEEMIEDTRLDVELRLASGLRPKELHMMGRRSKDYYDSLASLSGLES-VSPVVLQIYFD 399

Query: 180 SFARRCEDFTAFRKDKYKIINE 201
              R   DF+ FR+DKYK++++
Sbjct: 400 GIDRFMCDFSHFREDKYKLLDK 421

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193659750|ref|XP_001944207.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380027061|ref|XP_003697254.1| PREDICTED: dimethylaniline monooxygenase [N-oxide-forming] 2-like [Apis florea] Back     alignment and taxonomy information
>gi|66500583|ref|XP_394164.2| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 3-like [Apis mellifera] Back     alignment and taxonomy information
>gi|91095259|ref|XP_973683.1| PREDICTED: similar to dimethylaniline monooxygenase [Tribolium castaneum] gi|270017047|gb|EFA13493.1| hypothetical protein TcasGA2_TC016303 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383864815|ref|XP_003707873.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350425213|ref|XP_003494048.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709203|ref|XP_003393201.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|312371814|gb|EFR19906.1| hypothetical protein AND_21611 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|156537946|ref|XP_001608165.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX3-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
FB|FBgn0033079429 Fmo-2 "Flavin-containing monoo 0.949 0.477 0.365 3.6e-34
FB|FBgn0034943416 Fmo-1 "Flavin-containing monoo 0.949 0.492 0.362 9.8e-32
ZFIN|ZDB-GENE-031010-24449 zgc:77439 "zgc:77439" [Danio r 0.916 0.440 0.301 1e-21
UNIPROTKB|Q8MP06456 sno1 "Senecionine N-oxygenase" 0.921 0.436 0.301 1.8e-21
UNIPROTKB|E1BUH0536 LOC100857694 "Dimethylaniline 0.907 0.365 0.294 4.2e-17
TAIR|locus:2009754459 FMO GS-OX1 "AT1G65860" [Arabid 0.939 0.442 0.315 1.3e-16
TAIR|locus:2203891462 FMO GS-OX3 "AT1G62560" [Arabid 0.685 0.320 0.333 1.7e-16
TAIR|locus:2201971459 FMO GS-OX5 "flavin-monooxygena 0.759 0.357 0.333 2.1e-16
TAIR|locus:2177813460 AT5G07800 "AT5G07800" [Arabido 0.611 0.286 0.360 2.8e-16
WB|WBGene00016728408 C46H11.2 [Caenorhabditis elega 0.842 0.446 0.293 4.2e-16
FB|FBgn0033079 Fmo-2 "Flavin-containing monooxygenase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 371 (135.7 bits), Expect = 3.6e-34, P = 3.6e-34
 Identities = 76/208 (36%), Positives = 116/208 (55%)

Query:     1 VFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLH 60
             VFLSHH        F  NV +KPD+   T  G  F DGS E  D +++CTGY Y +P L 
Sbjct:   217 VFLSHHLSTTPNTAFMGNVTQKPDVKRFTKDGAVFTDGSTESFDHVMFCTGYKYTFPCLS 276

Query:    61 ESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLP 120
                G++V++  VQPL+KH INI HP+M  +G+P + +  ++FD+QVRF L+   G    P
Sbjct:   277 TDVGVQVIDNFVQPLWKHCININHPTMAFVGLPFNVIPTHIFDMQVRFTLKFFTGQRKFP 336

Query:   121 SKAEMLADTDQDI--RAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYF 178
             S+ +M+AD +Q+I  R           H M  R   Y N LAS+  G   + PV+ K+  
Sbjct:   337 SREQMIADLEQEIGERWGCGVRNQKKAHQMGERQFVYYNELASIA-GIENIKPVIHKLMK 395

Query:   179 ESFARRCEDFTAFRKDKYKIINEKVFVR 206
             +   +   +   +R +KY I++++ F++
Sbjct:   396 DCGKKYIFELDTYRSNKYTILDDENFLK 423
GO:0004499 "N,N-dimethylaniline monooxygenase activity" evidence=ISS;NAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
FB|FBgn0034943 Fmo-1 "Flavin-containing monooxygenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031010-24 zgc:77439 "zgc:77439" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MP06 sno1 "Senecionine N-oxygenase" [Tyria jacobaeae (taxid:179666)] Back     alignment and assigned GO terms
UNIPROTKB|E1BUH0 LOC100857694 "Dimethylaniline monooxygenase [N-oxide-forming]" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2009754 FMO GS-OX1 "AT1G65860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203891 FMO GS-OX3 "AT1G62560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201971 FMO GS-OX5 "flavin-monooxygenase glucosinolate S-oxygenase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177813 AT5G07800 "AT5G07800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00016728 C46H11.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 3e-20
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 5e-19
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information 
 Score = 87.6 bits (217), Expect = 3e-20
 Identities = 45/144 (31%), Positives = 75/144 (52%), Gaps = 14/144 (9%)

Query: 35  FQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIE-HPSMCIIGIP 93
           F++G     D I++CTGY Y +PFL  +  +++    V+PLYKH+      P +  IG+P
Sbjct: 269 FKNGKVVYADTIVHCTGYKYHFPFLETNGYMRIDENRVEPLYKHVFPPALAPGLSFIGLP 328

Query: 94  GDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQS-----THTHVM 148
              + F MF++Q ++   ++ G VTLPS+ +M+    +DI A     ++      +TH +
Sbjct: 329 AMGIQFVMFEIQSKWVAAVLSGRVTLPSEDKMM----EDINAWYASLEALGIPKRYTHKL 384

Query: 149 HLRSEKYLNSLASMMRGESPVPPV 172
                +YLN +A     E   P V
Sbjct: 385 GKIQSEYLNWIAE----ECGCPLV 404

Length = 461
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 100.0
PLN02172461 flavin-containing monooxygenase FMO GS-OX 100.0
KOG1399|consensus448 99.87
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.74
PRK13512438 coenzyme A disulfide reductase; Provisional 97.3
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.23
PRK07846451 mycothione reductase; Reviewed 97.15
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.11
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.08
PRK06116450 glutathione reductase; Validated 96.91
PLN02507499 glutathione reductase 96.9
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.9
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.82
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.81
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 96.81
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.68
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 96.64
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 96.53
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 96.5
PRK07845466 flavoprotein disulfide reductase; Reviewed 96.25
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 96.23
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.23
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 96.21
PTZ00052499 thioredoxin reductase; Provisional 96.12
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 96.07
PRK09564444 coenzyme A disulfide reductase; Reviewed 95.88
PRK14989 847 nitrite reductase subunit NirD; Provisional 95.83
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 95.48
PRK06327475 dihydrolipoamide dehydrogenase; Validated 95.45
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 95.43
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 95.43
PRK06370463 mercuric reductase; Validated 95.4
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 95.13
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 95.11
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 95.07
PRK06292460 dihydrolipoamide dehydrogenase; Validated 94.9
PTZ00153659 lipoamide dehydrogenase; Provisional 94.85
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 94.8
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 94.77
PRK05976472 dihydrolipoamide dehydrogenase; Validated 94.6
PRK13748561 putative mercuric reductase; Provisional 94.56
TIGR02053463 MerA mercuric reductase. This model represents the 94.55
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 94.5
PTZ00058561 glutathione reductase; Provisional 94.36
PRK12771564 putative glutamate synthase (NADPH) small subunit; 93.95
PRK098531019 putative selenate reductase subunit YgfK; Provisio 93.87
PLN02546558 glutathione reductase 93.79
PRK14694468 putative mercuric reductase; Provisional 93.74
PRK14727479 putative mercuric reductase; Provisional 93.37
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 93.14
PRK12770352 putative glutamate synthase subunit beta; Provisio 92.47
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 92.38
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 92.3
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 92.14
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 92.12
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 91.67
PRK12831464 putative oxidoreductase; Provisional 91.23
KOG1336|consensus478 90.82
PRK10262321 thioredoxin reductase; Provisional 90.76
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 90.35
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 89.68
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 89.46
PRK12814652 putative NADPH-dependent glutamate synthase small 89.11
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 88.58
PRK13984604 putative oxidoreductase; Provisional 87.15
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 86.31
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 85.88
KOG2495|consensus491 84.98
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 84.8
PRK07846 451 mycothione reductase; Reviewed 81.16
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 80.74
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 80.7
PF01134392 GIDA: Glucose inhibited division protein A; InterP 80.08
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-43  Score=325.10  Aligned_cols=197  Identities=31%  Similarity=0.557  Sum_probs=100.9

Q ss_pred             CCcCCCCC-----CCcEEcCCceEEecCcEEEcCCCEE-eccEEEEcCCCCCCCCCCCCCCCeEecCCcccccccccccC
Q psy14914          9 HVKKLRFP-----NNVVKKPDIAELTPTGVRFQDGSYE-QVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINI   82 (216)
Q Consensus         9 ~~~~~~~p-----~~V~~~~~I~~~~~~~V~f~dG~~~-~~D~II~aTGy~~~~pfl~~~~~l~~~~~~v~~ly~~~~~~   82 (216)
                      +.++|+|+     ++|++++.|++|++++|+|.||+++ ++|+|||||||+.+||||++++ +...++.+ .||+++|++
T Consensus       281 ~~ind~l~~~i~~G~i~vk~~I~~~~~~~v~F~DGs~~e~vD~II~~TGY~~~fpFL~~~~-~~~~~~~~-~LYk~vfp~  358 (531)
T PF00743_consen  281 PTINDELPNRIRSGRIKVKPDIKRFTENSVIFEDGSTEEDVDVIIFCTGYKFSFPFLDESL-IKVDDNRV-RLYKHVFPP  358 (531)
T ss_dssp             ------------------EE-EEEE-SSEEEETTSEEEEE-SEEEE---EE---TTB-TTT-T-S-SSSS-SEETTTEET
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc-cccccccc-ccccccccc
Confidence            77888888     4688899999999999999999986 7999999999999999999765 44455665 799999998


Q ss_pred             C--CCCeEEEccCCCc-chhhHHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHHHhcCCCCceeeccccHHHHHHHH
Q psy14914         83 E--HPSMCIIGIPGDT-VVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSL  159 (216)
Q Consensus        83 ~--~P~L~fiG~~~~~-~~~~~~e~Qa~~ia~~~~g~~~LPs~~em~~~~~~~~~~~~~~~~~r~~h~~~~~~~~Y~d~L  159 (216)
                      +  .|||+|||++++. +.|+++|+||||+|++|+|+.+||+.++|+++++++.+++.+++.....|.+.+++..|+|+|
T Consensus       359 ~~~~ptLafIG~~~~~g~~fp~~ElQArw~a~v~sG~~~LPs~~~M~~~i~~~~~~~~~~~~~~~~~~~~~d~~~y~deL  438 (531)
T PF00743_consen  359 NLDHPTLAFIGLVQPFGSIFPIFELQARWAARVFSGRVKLPSKEEMMEEIEEEQEWRAKRFGFSPRHTIQVDYIDYMDEL  438 (531)
T ss_dssp             ETTSTTEEESS-SBSSS-HHHHHHHHHHHHHHHHTTSS----HHHHHHHHHHHHHHHHT--SHHHHHHHHHHHHHHHHTT
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            5  5999999999875 479999999999999999999999999999999988776655542122344678999999999


Q ss_pred             HHHhcCCCCChHHHHHHH-HhHHHhHhccCCCCCCCCeeeCCCCccccCCCCC
Q psy14914        160 ASMMRGESPVPPVLLKIY-FESFARRCEDFTAFRKDKYKIINEKVFVREPGAA  211 (216)
Q Consensus       160 ~~~~~g~~p~~~~~~~~~-~~~~~~~~~~~~~y~~~~Yr~~~~~~~~~~~~~~  211 (216)
                      |+++ |+.|   .+++++ .++.+++..+++++.+++|||.||++|.++++|.
T Consensus       439 A~~i-G~~P---~~~~l~~~dp~l~~~~~~gp~~p~~YRL~Gpg~w~gar~ai  487 (531)
T PF00743_consen  439 AREI-GCKP---NFWKLFLTDPKLARKLYFGPCTPYQYRLFGPGKWPGAREAI  487 (531)
T ss_dssp             S----------------------------------------------------
T ss_pred             cccc-cccc---ccccccccccccccccccccccccccccccccccccccccc
Confidence            9999 9998   555554 6899999999999999999999999999999986

Using an NADPH cofactor and FAD prosthetic group, these microsomal proteins catalyse the oxygenation of nucleophilic nitrogen, sulphur, phosphorous and selenium atoms in a range of structurally diverse compounds. FMOs have been implicated in the metabolism of a number of pharmaceuticals, pesticides and toxicants. In man, lack of hepatic FMO-catalysed trimethylamine metabolism results in trimethylaminuria (fish odour syndrome). Five mammalian forms of FMO are now known and have been designated FMO1-FMO5 [, , , , ]. This is a recent nomenclature based on comparison of amino acid sequences, and has been introduced in an attempt to eliminate confusion inherent in multiple, laboratory-specific designations and tissue-based classifications []. Following the determination of the complete nucleotide sequence of Saccharomyces cerevisiae (Baker's yeast) [], a novel gene was found to encode a protein with similarity to mammalian monooygenases.; GO: 0004499 flavin-containing monooxygenase activity, 0050660 flavin adenine dinucleotide binding, 0050661 NADP binding, 0055114 oxidation-reduction process; PDB: 2GVC_E 1VQW_B 2GV8_B 2XVI_B 2XVH_B 2XLS_A 2XLR_A 2XLU_D 2XLP_B 2XVE_A ....
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
2xvi_A464 Crystal Structure Of The Mutant Bacterial Flavin Co 5e-18
2xve_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 5e-18
2xls_A461 Joint-Functions Of Protein Residues And Nadp(H) In 5e-18
2xlr_A461 Joint-Functions Of Protein Residues And Nadp(H) In 5e-18
2xlp_A461 Joint-Functions Of Protein Residues And Nadp(H) In 5e-18
2vq7_A461 Bacterial Flavin-Containing Monooxygenase In Comple 6e-18
2xvf_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 1e-14
1vqw_A457 Crystal Structure Of A Protein With Similarity To F 3e-08
2gv8_A447 Crystal Structure Of Flavin-Containing Monooxygenas 3e-08
>pdb|2XVI|A Chain A, Crystal Structure Of The Mutant Bacterial Flavin Containing Monooxygenase (Y207s) Length = 464 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 89/188 (47%), Gaps = 6/188 (3%)
Query: 14  RFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQ 73
           ++P N  ++P++  +      F DGS E+VD I+ CTGY + +PFL++   + V N  + 
Sbjct: 236 KWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRL-VTNNRLW 294
Query: 74  P--LYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQ 131
           P  LYK ++  ++P    IG+      F MFD Q  +   ++ G + LPSK EM AD+  
Sbjct: 295 PLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADS-- 352
Query: 132 DIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFESFARRCEDFTAF 191
            +    KE        M+     Y+ +L  M    S   P   K + E    + E+   F
Sbjct: 353 -MAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTF 411
Query: 192 RKDKYKII 199
           R   Y+ +
Sbjct: 412 RDHSYRSL 419
>pdb|2XVE|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|2XLS|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78lys Mutant Length = 461 Back     alignment and structure
>pdb|2XLR|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78asp Mutant Length = 461 Back     alignment and structure
>pdb|2XLP|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen- Activation By Flavin-Containing Monooxygenase: Asn78ser Mutant Length = 461 Back     alignment and structure
>pdb|2VQ7|A Chain A, Bacterial Flavin-Containing Monooxygenase In Complex With Nadp: Native Data Length = 461 Back     alignment and structure
>pdb|2XVF|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|1VQW|A Chain A, Crystal Structure Of A Protein With Similarity To Flavin- Containing Monooxygenases And To Mammalian Dimethylalanine Monooxygenases Length = 457 Back     alignment and structure
>pdb|2GV8|A Chain A, Crystal Structure Of Flavin-Containing Monooxygenase (Fmo) From S.Pombe And Nadph Cofactor Complex Length = 447 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 2e-43
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 1e-33
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 2e-09
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 6e-05
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 6e-05
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
 Score =  150 bits (380), Expect = 2e-43
 Identities = 54/208 (25%), Positives = 90/208 (43%), Gaps = 4/208 (1%)

Query: 1   VFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLH 60
             +S +       ++P N  ++P++  +      F DGS E+VD I+ CTGY + +PFL+
Sbjct: 223 KLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLN 282

Query: 61  ESCGIKVVNKN-VQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTL 119
           +   +   N+     LYK ++  ++P    IG+      F MFD Q  +   ++ G + L
Sbjct: 283 DDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPL 342

Query: 120 PSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLLKIYFE 179
           PSK EM AD+        KE        M+     Y+ +L  M    S   P   K + E
Sbjct: 343 PSKEEMKADSMAWR---EKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLE 399

Query: 180 SFARRCEDFTAFRKDKYKIINEKVFVRE 207
               + E+   FR   Y+ +       +
Sbjct: 400 WKHHKKENIMTFRDHSYRSLMTGTMAPK 427
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.98
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.9
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.51
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.49
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.45
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.23
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.74
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.56
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.2
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.9
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.89
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.78
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.77
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.68
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.64
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.53
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.53
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.52
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.47
4dna_A463 Probable glutathione reductase; structural genomic 97.46
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.44
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.43
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.43
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.42
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.42
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.38
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.38
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.38
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.37
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.37
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.34
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.33
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.33
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.32
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.31
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.27
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.27
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.24
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.23
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.19
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.19
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.17
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.17
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.13
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.13
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.1
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.08
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.05
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.02
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.02
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.01
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 96.99
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 96.96
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.95
1ojt_A482 Surface protein; redox-active center, glycolysis, 96.95
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.91
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.91
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 96.9
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.9
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.89
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.88
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 96.88
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.87
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 96.86
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 96.77
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.76
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.72
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.7
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.57
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 96.21
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 96.15
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 96.12
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.99
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 95.98
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 95.87
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 95.79
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 95.7
2ywl_A180 Thioredoxin reductase related protein; uncharacter 95.51
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 95.48
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 95.42
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 95.12
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 95.05
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 94.88
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 94.79
2cul_A232 Glucose-inhibited division protein A-related PROT 94.48
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 94.01
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 93.38
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 92.79
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 92.58
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 91.81
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 89.13
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 88.79
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 85.87
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 84.42
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 80.55
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 80.08
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
Probab=99.98  E-value=9.7e-32  Score=244.13  Aligned_cols=202  Identities=25%  Similarity=0.406  Sum_probs=172.7

Q ss_pred             CeecccCCCCcCCCCCCCcEEcCCceEEecCcEEEcCCCEEeccEEEEcCCCCCCCCCCCCCCCeEecCC-ccccccccc
Q psy14914          1 VFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNK-NVQPLYKHL   79 (216)
Q Consensus         1 v~~s~~~~~~~~~~~p~~V~~~~~I~~~~~~~V~f~dG~~~~~D~II~aTGy~~~~pfl~~~~~l~~~~~-~v~~ly~~~   79 (216)
                      |+++++....+...+|.+|++++.|+++++++|+|+||+++++|+||+||||++++|||..+.++..+++ ++.++|+++
T Consensus       223 V~li~~~~~~~~~~~~~~V~~~~~V~~i~~~~V~~~dG~~i~~D~Vi~atG~~p~~~~l~~~~gl~~~~~~~v~~~~~~~  302 (464)
T 2xve_A          223 KLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGV  302 (464)
T ss_dssp             EEEEECSSCCCCCCCCTTEEECSCEEEECSSEEEETTSCEEECSEEEECCCBCCCCTTBCTTTCCCCCSSSCCSSEETTT
T ss_pred             EEEEEECCCCCCCCCCCceEEcCCeEEEeCCEEEECCCCEEeCCEEEECCCCCCCCCCcCcccccccCCCcccccccceE
Confidence            4555554444555688899999999999999999999999999999999999999999986566666665 556899999


Q ss_pred             ccCCCCCeEEEccCCCcchhhHHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHHHhcC--CCCceeeccccHHHHHH
Q psy14914         80 INIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKES--QSTHTHVMHLRSEKYLN  157 (216)
Q Consensus        80 ~~~~~P~L~fiG~~~~~~~~~~~e~Qa~~ia~~~~g~~~LPs~~em~~~~~~~~~~~~~~~--~~r~~h~~~~~~~~Y~d  157 (216)
                      +.++.|||+++|.+.....++++|.||+|+|+.++|+.+||+.++|+++++++.+ +....  ..|++|.    +.+|+|
T Consensus       303 ~~t~~p~i~aiGd~~~~~~~~~a~~qa~~~a~~l~G~~~lP~~~~m~~~~~~~~~-~~~~~~~~~~~~~~----~~~Y~~  377 (464)
T 2xve_A          303 VWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWRE-KELTLVTAEEMYTY----QGDYIQ  377 (464)
T ss_dssp             EESSSTTEEECSCSCCSSCHHHHHHHHHHHHHHHTTSSCCCCHHHHHHHHHHHHH-HHHTCCSHHHHHHH----HHHHHH
T ss_pred             ecCCCCCEEEEeCcccccchHHHHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHHH-HhhccCCCCCcccc----HHHHHH
Confidence            9999999999999887667899999999999999999999999999999887655 22221  2455653    578999


Q ss_pred             HHHHHhcCCCCC-hHHHHHHHHhHHHhHhccCCCCCCCCeeeCCCCccccCC
Q psy14914        158 SLASMMRGESPV-PPVLLKIYFESFARRCEDFTAFRKDKYKIINEKVFVREP  208 (216)
Q Consensus       158 ~L~~~~~g~~p~-~~~~~~~~~~~~~~~~~~~~~y~~~~Yr~~~~~~~~~~~  208 (216)
                      +|++++ |++++ +++++++|..+...+..++..||+.+|+++.++++....
T Consensus       378 ~l~~~~-g~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~  428 (464)
T 2xve_A          378 NLIDMT-DYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKH  428 (464)
T ss_dssp             HHHTTS-SSCCCCHHHHHHHHHHHHHHHHHCTTTGGGCCCBCTTTCCBCCCC
T ss_pred             HHHHHc-CCCCCChHHHHHHHHHHHHHHHhchhhhcccceeEecCceeeccC
Confidence            999999 99987 788999999999999999999999999999999988664
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 2e-13
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 1e-05
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 0.002
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavin-dependent monoxygenase SPBP16F5.08c
species: Schizosaccharomyces pombe [TaxId: 4896]

 Score = 65.8 bits (159), Expect = 2e-13
 Identities = 28/144 (19%), Positives = 54/144 (37%), Gaps = 3/144 (2%)

Query: 57  PFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGY 116
                   +     +V  +Y+H+  I  P++  +G+    V F     Q  F  ++  G 
Sbjct: 192 KLKSPETKLIDDGSHVHNVYQHIFYIPDPTLAFVGLALHVVPFPTSQAQAAFLARVWSGR 251

Query: 117 VTLPSKAEMLADTDQDIRAHRKESQSTHTHVMHLRSEKYLNSLASMMRGESPVPPVLL-- 174
           + LPSK E L   D+ + +    +   H  + + +   Y+N L    +  +PV       
Sbjct: 252 LKLPSKEEQLKWQDELMFSLSGANNMYH-SLDYPKDATYINKLHDWCKQATPVLEEEFPS 310

Query: 175 KIYFESFARRCEDFTAFRKDKYKI 198
             + E      E+  + R   + I
Sbjct: 311 PYWGEKERSIRENMWSIRAKFFGI 334
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.7
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.78
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.56
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.85
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.68
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.34
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.05
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 95.91
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.65
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.62
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.57
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.54
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.84
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.25
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.2
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.99
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 89.38
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 88.65
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 88.34
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 88.16
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 88.08
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 86.06
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 85.61
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 85.51
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.24
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 82.73
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 81.79
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 81.6
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavin-dependent monoxygenase SPBP16F5.08c
species: Schizosaccharomyces pombe [TaxId: 4896]

Probab=99.70  E-value=6e-17  Score=138.09  Aligned_cols=138  Identities=20%  Similarity=0.347  Sum_probs=102.0

Q ss_pred             CceEEec--Cc--EEEcCCC------EEeccEEEEcCCCCCC--CCCC------------CCCCCeEecCCccccccccc
Q psy14914         24 DIAELTP--TG--VRFQDGS------YEQVDIILYCTGYTYR--YPFL------------HESCGIKVVNKNVQPLYKHL   79 (216)
Q Consensus        24 ~I~~~~~--~~--V~f~dG~------~~~~D~II~aTGy~~~--~pfl------------~~~~~l~~~~~~v~~ly~~~   79 (216)
                      .|++++.  +.  |++.|+.      +..+|+||+|||+...  .|.+            ..+..+...++++.+||+|+
T Consensus       135 ~V~~v~~~~~~w~Vt~~~~~~~~~~~~~~~d~VI~AtG~~s~p~~~~~~~~~~p~~~~f~~~~~~~~~~~~~~~~ly~~~  214 (335)
T d2gv8a1         135 DVLDIEKKDGSWVVTYKGTKAGSPISKDIFDAVSICNGHYEVPYTGYLYSVPFPSLAKLKSPETKLIDDGSHVHNVYQHI  214 (335)
T ss_dssp             EEEEEEEETTEEEEEEEESSTTCCEEEEEESEEEECCCSSSSBCCCBCCCCCCHHHHSCCSTTTCCCSSSSSCCSEETTT
T ss_pred             EEEEEEecCCEEEEEEEecCCCCeEEEEEeeEEEEcccccccceecccccCCCCcchhcccCccceeccccceeeeeccc
Confidence            4555553  32  6665432      2469999999998642  2211            11111223455677999999


Q ss_pred             ccCCCCCeEEEccCCCcchhhHHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHHHhcCCCCceeec-cccHHHHHHH
Q psy14914         80 INIEHPSMCIIGIPGDTVVFYMFDLQVRFFLQLMKGYVTLPSKAEMLADTDQDIRAHRKESQSTHTHVM-HLRSEKYLNS  158 (216)
Q Consensus        80 ~~~~~P~L~fiG~~~~~~~~~~~e~Qa~~ia~~~~g~~~LPs~~em~~~~~~~~~~~~~~~~~r~~h~~-~~~~~~Y~d~  158 (216)
                      +++..|+|+|+|.+..+.+++++|+||+|+|++++|+.+||+.++|.++..++..++  ++..+.+|.+ ...+..|+++
T Consensus       215 ~~~~~p~l~f~G~~~~v~~~~~~e~Qa~~~a~~~~g~~~Lps~~~m~~~~~~~~~~~--~~~~~~~~~~~~~~~~~y~~~  292 (335)
T d2gv8a1         215 FYIPDPTLAFVGLALHVVPFPTSQAQAAFLARVWSGRLKLPSKEEQLKWQDELMFSL--SGANNMYHSLDYPKDATYINK  292 (335)
T ss_dssp             EETTCTTEEESSCCBSSCHHHHHHHHHHHHHHHHTTSSCCCCHHHHHHHHHHHHHHH--TTCGGGTTBCTTTHHHHHHHH
T ss_pred             ccCCCCceEEeeeEEEEecCCchHHHHHHHHHHHcCCccCCCcchhhhhhHHHHHhh--cccCccceecCCchHHHHHHH
Confidence            999999999999999888999999999999999999999999999999887765543  2334455655 3567899999


Q ss_pred             HHHHh
Q psy14914        159 LASMM  163 (216)
Q Consensus       159 L~~~~  163 (216)
                      |++++
T Consensus       293 L~~~~  297 (335)
T d2gv8a1         293 LHDWC  297 (335)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            99876
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure