Diaphorina citri psyllid: psy14931


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MTSVTDMVSYYTLPSTVMNHEVHKSIKAAYSFYNVSFKTKWVDLMQDALITAKNEGFDVFNALDLMENKEFLGPLKFGIGDGNLQYYLYNWKCPSIPPNKIGLVLQ
cccccEEEEEEEccCEEccccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccEEEEECccccccccccEEEEEc
MTSVTDMVSYYTLPSTVMNHEVHKSIKAAYSFYNVSFKTKWVDLMQDALITAKNEGFDVFNALDLMENKEFLGPLKFGIGDGNLQYYLYNWKCPSIPPNKIGLVLQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSVTDMVSYYTLPSTVMNHEVHKSIKAAYSFYNVSFKTKWVDLMQDALITAKNEGFDVFNALDLMENKEFLGPLKFGIGDGNLQYYLYNWKCPSIPPNKIGLVLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycylpeptide N-tetradecanoyltransferase 1 Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.confidentQ8K1Q0
Glycylpeptide N-tetradecanoyltransferase 2 Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.confidentQ9N181
Glycylpeptide N-tetradecanoyltransferase 1 Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.confidentO70310

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0030054 [CC]cell junctionprobableGO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0046788 [BP]egress of virus within host cellprobableGO:0044419, GO:0044703, GO:0009987, GO:0019067, GO:0022414, GO:0006810, GO:0019048, GO:0044764, GO:0075733, GO:0022415, GO:0044766, GO:0019058, GO:0008150, GO:0016032, GO:0051179, GO:0044403, GO:0051701, GO:0051234, GO:0000003, GO:0051704
GO:0009249 [BP]protein lipoylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0018065, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0018008 [BP]N-terminal peptidyl-glycine N-myristoylationprobableGO:0031365, GO:0044249, GO:0006499, GO:0034645, GO:1901576, GO:0042158, GO:0043170, GO:0043543, GO:0044260, GO:0018377, GO:0018193, GO:0071704, GO:0044267, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006497, GO:0044238, GO:0019538, GO:0018201, GO:0009058, GO:0044237, GO:0006498, GO:0009059, GO:0042157
GO:0004379 [MF]glycylpeptide N-tetradecanoyltransferase activityprobableGO:0019107, GO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0016410, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IU1, chain A
Confidence level:very confident
Coverage over the Query: 2-106
View the alignment between query and template
View the model in PyMOL