Diaphorina citri psyllid: psy14939

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-

ISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGNNPPSPLIDVKDDDDNELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQNSLSAMSHQTPGIPNPYLMYPRPGGTLPFYPPSLMPPYPGLFQPNQTPTPHHPFLSNPLLFNQSMKSNEELDRAKININLSVEAYYRFQLQKNVQQSEEKRKNSPSPRKSDVPKTSGGKLFEFSESKDSPPTAEEANSNQRPSPARPTISASNAVTYPDPREQLEVVTTDVKSDVNQKPRDKLTNFSIDKLSGKMDSPKDEDASEESKPKKAKYCDQPLDLSIASKSSIDSDKQDANETFVKTPATSPEIGKDESVINKSSPTPPDDPVEESKRSPTPQIVSRSPSPIKNRSPSPPVSKANTTPMAYPKPIHPMSLEAFFPLKNFGSRSYPPFPPPHPTDPHERLCPPSLPGFNPQRSFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFLSDETEDTFIPQDFRKSPSEIENGSPISYSLKTKGDQEIINNNTSSAADAITLHA

cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEccccccccccccccccccccccccCEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccHHcccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccc

ISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGNNPPSPLIDVKDDDDNELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQNSLSAMSHQTPGIPNPYLMYPRPGGTLPFYPPSLMPPYPGLFQPNQTPTPHHPFLSNPLLFNQSMKSN**LDRAKININLSVEAYYRFQLQKNVQQSEEKRKNSPSPRKSDVPKTSGG***********************************************************************************************************************************************************************************************PIHPMSLEAFFPLKNFGSRSYPPFPPPHPTDPHERLCPPSLPGFNPQRSFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFLSDETEDTFIPQDFRKSPSEIENGSPISYSLKTKGDQEIINNNTSSAADAITLHA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008150 [BP]	biological_process	probable

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 41-114,196-276
View the alignment between query and template
View the model in PyMOL

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 69-114,196-304
View the alignment between query and template
View the model in PyMOL

Template: 2GLI, chain A
Confidence level:very confident
Coverage over the Query: 196-335
View the alignment between query and template
View the model in PyMOL

Template: 2YT9, chain A
Confidence level:very confident
Coverage over the Query: 758-845
View the alignment between query and template
View the model in PyMOL

Template: 1EJ6, chain B
Confidence level:probable
Coverage over the Query: 718-754
View the alignment between query and template
View the model in PyMOL