Psyllid ID: psy14939


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-
ISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGNNPPSPLIDVKDDDDNELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQNSLSAMSHQTPGIPNPYLMYPRPGGTLPFYPPSLMPPYPGLFQPNQTPTPHHPFLSNPLLFNQSMKSNEELDRAKININLSVEAYYRFQLQKNVQQSEEKRKNSPSPRKSDVPKTSGGKLFEFSESKDSPPTAEEANSNQRPSPARPTISASNAVTYPDPREQLEVVTTDVKSDVNQKPRDKLTNFSIDKLSGKMDSPKDEDASEESKPKKAKYCDQPLDLSIASKSSIDSDKQDANETFVKTPATSPEIGKDESVINKSSPTPPDDPVEESKRSPTPQIVSRSPSPIKNRSPSPPVSKANTTPMAYPKPIHPMSLEAFFPLKNFGSRSYPPFPPPHPTDPHERLCPPSLPGFNPQRSFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFLSDETEDTFIPQDFRKSPSEIENGSPISYSLKTKGDQEIINNNTSSAADAITLHA
cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccHHHcccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccc
cccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccccccEccccHHHHHHHHccccccccccccccEcccccHHHHHHHccccccccEEcccccccEccccHHHHHHHHcccccccccccccEcccccHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHHccccccccccccccccHHccHHHHHHHHHHHccccccccccHHHHHHHHccccccccccHcccccccccHHHHHcEEEcccccccccccccccccccccccccEEEEccccccccEEccccccEEccccccEEEEccccccccEcccccccccccccccEEEEcccccccccccccccEEEccccEEEEEccccccccccccccEccccccEccccEEEEEEcccccccccccccccccEEccccccccccEEEEEccccccEEcccccccEccccccHcHEEEccccccccccccccEcccccccEccccHHHHHcHHcccccccEEEcccccccEcccccEEcccccccEccHccccEcccccEEccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccccEcccccccEccccHHHHHHHHccccccEEEEcccccccEcccccccEccccccEEEEEEEEcccccccEccHccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccccccccccEEEcccccHHccEEEEEcc
ispyankpfqeiltsqnnavngssskttkdryackycgkvfprsanltrhlrthtgeqpykckycersfsissNLQRHVRnihnkekpfkcplcdrcfgqqtnldrhlkkheaddgsglvsmadspessneneredAYFDEIRSFMGKvtysgdvaynqenlytgnnppsplidvkddddneledhlitghryppdqyrcescsqtfcwrphlnfhqaqvhgrkfpcenctkvfsdpsnlqrhirthhVGARQHACQEcgktfatssglkqhthihssvkpfrcevCHKAYTQFSNLCRHKrmhancrmqikcvkcdqsfstvtslskhkrfcdsttpgttpsgqnslsamshqtpgipnpylmyprpggtlpfyppslmppypglfqpnqtptphhpflsnpllfnqsmKSNEELDRAKININLSVEAYYRFQLQKNVQQseekrknspsprksdvpktsggklfefseskdspptaeeansnqrpsparptisasnavtypdpreqlEVVTTDvksdvnqkprdkltnfsidklsgkmdspkdedaseeskpkkakycdqpldlsiaskssidsdkqdanetfvktpatspeigkdesvinkssptppddpveeskrsptpqivsrspspiknrspsppvskanttpmaypkpihpmsleaffplknfgsrsyppfppphptdpherlcppslpgfnpqrsfpflglmnginnslgvnrtpyehllrsqispyankpfqeiltsqnnavngssskttkdryackycgkvfprsanltrhlrthtgeqpykckycersfsissNLQRHVRnihnkekpfkcplcdrcfgqqtnldrhlkkheaddgsglvsmadspessneneredAYFDEIRSFMGKvtysgdvaynqenlytgtnppsplidvkddddneseflsdetedtfipqdfrkspseiengspisyslktkgdqeiiNNNTSSAADAITLHA
ispyankpfqeiltsqnnavngssskttkdryaCKYCGkvfprsanltrhlrthtgeqpykCKYCERSFSISSNLQRHVRNIHnkekpfkcplCDRCFGQQTNLDRHLKKheaddgsglvsmadspessneneREDAYFDEIRSFMGKVTYSGDVAYNQENlytgnnppsplIDVKDDDDNELEDHLitghryppdqYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQNSLSAMSHQTPGIPNPYLMYPRPGGTLPFYPPSLMPPYPGLFQPNQTPTPHHPFLSNPLLFNQSMKSNEELDRAKININLSVEAYYRFQLQKnvqqseekrknspsprksdvpktsggklfefseskdspptaeeansnqrpsparptisasnavtypdpREQLEVVTTdvksdvnqkprdkltnfsidklsgkmdspkdedaseeskpkkakycdqpldLSIASkssidsdkqdaNETFvktpatspeigkdesvinkssptppddpveeskrsptpqivsrspspiknrspsppvskanTTPMAYPKPIHPMSLEAFFPLKNFGSRSYPPFPPPHPTDPHERLCPPSLPGFNPQRSFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYANKPFQEILTsqnnavngssskttkdryaCKYCGkvfprsanltrhlrthtgeqpykCKYCERSFSISSNLQRHVRNIHnkekpfkcplCDRCFGQQTNLDRHLKKheaddgsglvsmadspessneneREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFlsdetedtfipqdfrkspseiengspISYSLKTKGDQEIINNntssaadaitlha
ISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGNNPPSPLIdvkddddneledHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQNSLSAMSHQTPGIPNPYLMYPRPGGTlpfyppslmppypglfQPNQTPTPHHPFLSNPLLFNQSMKSNEELDRAKININLSVEAYYRFQLQKNVQQSEEKRKNSPSPRKSDVPKTSGGKLFEFSESKDSPPTAEEANSNQRPSPARPTISASNAVTYPDPREQLEVVTTDVKSDVNQKPRDKLTNFSIDKLSGKMDSPKDEDASEESKPKKAKYCDQPldlsiaskssidsdkqdaNETFVKTPATSPEIGKDESVINKSSPTPPDDPVEESKRSPTPQIVSRSPSPIKNRSPSPPVSKANTTPMAYPKPIHPMSLEAFFPLKNFGSRSYppfppphptdpHERLCPPSLPGFNPQRSFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFLSDETEDTFIPQDFRKSPSEIENGSPISYSLKTKGDQEIINNNTSSAADAITLHA
******************************RYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQT***********************************YFDEIRSFMGKVTYSGDVAYNQENLYT*********************HLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQSFSTVTSL************************************LMY*****TLPFY*******************************************AKININLSVEAYYRFQL************************************************************************************************************************************************************************************************************************************FF*************************************SFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYAN***********************DRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQT***********************************YFDEIRSFMGKVTYSGDVAYNQENLYT****************************************************************************
ISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGNNPPSPLIDVKDDDDNELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQNSLSAMSHQTPGIPNPYLMYPRPGGTLPFYPPSLMPPYPGLFQPNQTPTPHHPFLSNPLLFNQSMKSN**LDRAKININLSVEAYYRFQLQKNVQQSEEKRKNSPSPRKSDVPKTSGG***********************************************************************************************************************************************************************************************PIHPMSLEAFFPLKNFGSRSYPPFPPPHPTDPHERLCPPSLPGFNPQRSFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFLSDETEDTFIPQDFRKSPSEIENGSPISYSLKTKGDQEIINNNTSSAADAITLHA
ISPYANKPFQEILTSQNN**********KDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKH***********************EDAYFDEIRSFMGKVTYSGDVAYNQENLYTGNNPPSPLIDVKDDDDNELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRT*********CQECGKTFA*************SVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQ**********************************HQTPGIPNPYLMYPRPGGTLPFYPPSLMPPYPGLFQPNQTPTPHHPFLSNPLLFNQSMKSNEELDRAKININLSVEAYYRFQLQK***********************SGGKLFEFS***********************TISASNAVTYPDPREQLEVVTTDVKSDVNQKPRDKLTNFSIDKLS*********************YCDQPLDLSIASKSSIDSDKQDANETFVKTPATSPEIGKDESV********************************************NTTPMAYPKPIHPMSLEAFFPLKNFGSRSYPPFPPPHPTDPHERLCPPSLPGFNPQRSFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYANKPFQEILTSQNN**********KDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKH***********************EDAYFDEIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFLSDETEDTFIPQDFRKSPSEIENGSPISYSLKTKGDQEIINNNTSSAADAITLHA
ISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGNNPPSPLIDVKDDDDNELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQNSLSAMSHQTPGIPNPYLMYPRPGGTLPFYPPSLMPPYPGLFQPNQTPTPHHPFLSNPLLFNQSMKSNEELDRAKININLSVEAYYRFQLQKNVQQSEEKRKNSPSPRKSDVPKTSGGKLFEFSESKDSPPTAEEANSNQRPSPARPTISASNAVTYPDPREQLEVVTTDVKSDVNQKPRDKLTNFSIDKLSGKMDSPKDEDASEESKPKKAKYCDQPLDLSIASKSSIDSDKQDANETFVKTPATSPEIGKDESVINKSSPTPPDDPVEESKRSPTPQIVSRSPSPIKNRSPSPPVSKANTTPMAYPKPIHPMSLEAFFPLKNFGSRSYPPFPPPHPTDPHERLCPPSLPGFNPQRSFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFLSDETEDTFIPQDFRKSPSEIENGSPISYSLKTKGDQEIINNNTSSAADAITLH*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGNNPPSPLIDVKDDDDNELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHGRKFPCENCTKVFSDPSNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQNSLSAMSHQTPGIPNPYLMYPRPGGTLPFYPPSLMPPYPGLFQPNQTPTPHHPFLSNPLLFNQSMKSNEELDRAKININLSVEAYYRFQLQKNVQQSEEKRKNSPSPRKSDVPKTSGGKLFEFSESKDSPPTAEEANSNQRPSPARPTISASNAVTYPDPREQLEVVTTDVKSDVNQKPRDKLTNFSIDKLSGKMDSPKDEDASEESKPKKAKYCDQPLDLSIASKSSIDSDKQDANETFVKTPATSPEIGKDESVINKSSPTPPDDPVEESKRSPTPQIVSRSPSPIKNRSPSPPVSKANTTPMAYPKPIHPMSLEAFFPLKNFGSRSYPPFPPPHPTDPHERLCPPSLPGFNPQRSFPFLGLMNGINNSLGVNRTPYEHLLRSQISPYANKPFQEILTSQNNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFLSDETEDTFIPQDFRKSPSEIENGSPISYSLKTKGDQEIINNNTSSAADAITLHA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query971 2.2.26 [Sep-21-2011]
Q03112 1051 MDS1 and EVI1 complex loc yes N/A 0.213 0.196 0.522 1e-61
P14404 1042 MDS1 and EVI1 complex loc yes N/A 0.213 0.198 0.522 1e-61
Q9HAZ2 1276 PR domain zinc finger pro no N/A 0.279 0.212 0.425 6e-60
A2A935 1275 PR domain zinc finger pro yes N/A 0.207 0.157 0.537 3e-59
B7ZRU9 1055 MDS1 and EVI1 complex loc N/A N/A 0.212 0.195 0.517 2e-58
B7ZRM8 1050 MDS1 and EVI1 complex loc N/A N/A 0.219 0.202 0.510 2e-58
Q8I7Z8990 Transcription factor haml no N/A 0.130 0.128 0.704 2e-48
Q0VAW7879 Zinc finger protein 112 O no N/A 0.303 0.335 0.357 2e-39
Q5SXM1525 Zinc finger protein 678 O no N/A 0.325 0.601 0.330 7e-39
P0DKX0622 Zinc finger protein 728 O no N/A 0.297 0.464 0.336 9e-39
>sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 Back     alignment and function desciption
 Score =  238 bits (608), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 144/224 (64%), Gaps = 17/224 (7%)

Query: 179 DDNELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQ-AQVHGRKFPCENCTKVFSDP 237
           D   LE H+++       +Y+C+ C + F W+ +L  HQ +   G+ + CENC KVF+DP
Sbjct: 86  DLQSLEKHMLS--HTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDP 143

Query: 238 SNLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNL 297
           SNLQRHIR+ HVGAR HAC ECGKTFATSSGLKQH HIHSSVKPF CEVCHK+YTQFSNL
Sbjct: 144 SNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNL 203

Query: 298 CRHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDS--------------TTPGTTPS 343
           CRHKRMHA+CR QIKC  C Q FST +SL+KH+RFC+               + PGT   
Sbjct: 204 CRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAM 263

Query: 344 GQNSLSAMSHQTPGIPNPYLMYPRPGGTLPFYPPSLMPPYPGLF 387
            + S+  MSH  PG+ + +     P G      P     +PGLF
Sbjct: 264 DKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLF 307




Functions as a transcriptional regulator binding to DNA sequences in the promoter region of target genes and regulating positively or negatively their expression. Oncogene which plays a role in development, cell proliferation and differentiation. May also play a role in apoptosis through regulation of the JNK and TGF-beta signaling. Involved in hematopoiesis.
Homo sapiens (taxid: 9606)
>sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 Back     alignment and function description
>sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 Back     alignment and function description
>sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 Back     alignment and function description
>sp|B7ZRU9|EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis GN=mecom-a PE=1 SV=1 Back     alignment and function description
>sp|B7ZRM8|EVI1B_XENLA MDS1 and EVI1 complex locus protein EVI1-B OS=Xenopus laevis GN=mecom-b PE=2 SV=1 Back     alignment and function description
>sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster GN=ham PE=2 SV=1 Back     alignment and function description
>sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 Back     alignment and function description
>sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 Back     alignment and function description
>sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query971
322785887719 hypothetical protein SINV_13327 [Solenop 0.693 0.936 0.479 1e-172
380029940 1149 PREDICTED: LOW QUALITY PROTEIN: transcri 0.741 0.626 0.472 1e-166
242020553805 conserved hypothetical protein [Pediculu 0.762 0.919 0.484 1e-166
350427487997 PREDICTED: LOW QUALITY PROTEIN: transcri 0.647 0.630 0.497 1e-163
340711407997 PREDICTED: LOW QUALITY PROTEIN: transcri 0.648 0.631 0.498 1e-163
345480353 1138 PREDICTED: hypothetical protein LOC10012 0.745 0.636 0.433 1e-149
332030441645 Ecotropic virus integration site 1 prote 0.613 0.924 0.454 1e-136
158296910966 AGAP008232-PA [Anopheles gambiae str. PE 0.654 0.658 0.411 1e-134
357610288849 hypothetical protein KGM_21146 [Danaus p 0.671 0.767 0.397 1e-122
270012294933 hypothetical protein TcasGA2_TC006417 [T 0.331 0.345 0.466 2e-81
>gi|322785887|gb|EFZ12506.1| hypothetical protein SINV_13327 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  611 bits (1575), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 399/832 (47%), Positives = 484/832 (58%), Gaps = 159/832 (19%)

Query: 181 NELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHG--RKFPCENCTKVFSDPS 238
           + L+ HL+T HRYP +Q+RC+SC + + WRP L  H+A VHG  R +PCENC KVF+DPS
Sbjct: 2   SRLDSHLVTCHRYPAEQHRCDSCPRAYAWRPLLVRHRAIVHGDLRNYPCENCPKVFTDPS 61

Query: 239 NLQRHIRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLC 298
           NLQRHIRTHHVGAR HAC ECGKTFATSSGLKQHTHIHSSVKPF+CEVC KAYTQFSNLC
Sbjct: 62  NLQRHIRTHHVGARSHACTECGKTFATSSGLKQHTHIHSSVKPFQCEVCFKAYTQFSNLC 121

Query: 299 RHKRMHANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQNSLSAMSHQTPGI 358
           RHKRMHA+CRMQIKCVKC QSFSTVTSLSKHKRFCDSTTP   P     L      TP  
Sbjct: 122 RHKRMHADCRMQIKCVKCGQSFSTVTSLSKHKRFCDSTTPTGPPGTMPQLP-----TPAT 176

Query: 359 PNPYLMYPRPG----GTLPFYPPSLMPPYPGLFQPNQTPTPHHP-FLSNPLLFNQSMKSN 413
            +P+L+YPRP     G LPFYPPSLM PYPG+F       P+ P FL+ PLLF   +   
Sbjct: 177 -SPFLVYPRPPVSLPGGLPFYPPSLMGPYPGIF-------PNAPNFLNTPLLFPPKI--- 225

Query: 414 EELDRAKININLSVEAYYRFQLQKNVQQSEEKRKNSPSPRKSDVPKTSGGKLFEFSESKD 473
           EE+                           EKR +SP   +   P+           +K 
Sbjct: 226 EEV---------------------------EKRSDSPRKERFTPPRVLS------QHNKV 252

Query: 474 SPPTAEEANSNQRPSPARPTISASNAVTYPDPREQLEVVTTDVKSDVNQKPRDKLTNFSI 533
           SP TAEEA S  RPSPARP +        P P                          S 
Sbjct: 253 SPSTAEEATSTFRPSPARPPVQ-------PTPE-------------------------SD 280

Query: 534 DKLSGKMDSPK-DEDASEESKPKKAKYCDQPLDLSIASKSSIDSDKQDANETFVKTPATS 592
           D LS + +S K +E   E     K +  +QPLDL + +K   D+  ++AN    +TP+ +
Sbjct: 281 DDLSKRRESAKSNERKMETESTSKEETTEQPLDLRVQTKKQ-DTISKNANRK-SRTPSPA 338

Query: 593 PEIGKDESVINKS--------SPTPPDDPVEESKRSPTPQIVSRSPSPIKNRSPSPPVSK 644
           P I  +E+             +  PP +   +  +  +P +  R+  PI++    PP   
Sbjct: 339 P-IPMEEAPTPPDPPKPEEEVAAPPPMELESKDVQGSSPHL--RTSLPIEH----PPT-- 389

Query: 645 ANTTP-MAYPKPIHPMSLEAFFPLKNFGSRSYPPFPPPH------PTDPHERLCPPSLPG 697
            NT P MAYP+PIHPM LE  +       RS   FP  H           E    P LP 
Sbjct: 390 -NTPPHMAYPRPIHPMFLETMY-------RSPATFPGFHSAPPPPGGATPESRLIPPLPP 441

Query: 698 FNPQRSFPFLG-LMNGINNSLGVNRTPYEHLLRSQISPYAN-KPFQEILTS----QNNAV 751
           F P R  PFLG LMNG++ +       ++ L R  +S +   KPFQE + S     ++  
Sbjct: 442 FAPPRGLPFLGSLMNGLSGARPGGG--FDLLARPPLSAFPGVKPFQEAVMSPHHHHHHHH 499

Query: 752 NGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVR 811
           +       KDRY+CK+CGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVR
Sbjct: 500 HHHVHGKMKDRYSCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVR 559

Query: 812 NIHNKEKPFKCPLCDRCFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFD 871
           NIH+K++PFKCPLC+RCFGQQTNLDRHLKKHEADDGSG+VS+ADSP SSNENERED YFD
Sbjct: 560 NIHDKQRPFKCPLCERCFGQQTNLDRHLKKHEADDGSGVVSVADSPGSSNENEREDTYFD 619

Query: 872 EIRSFMGKVTYSGDVAYNQENLYTGTNPPSPLIDVKDDDDNESEFLSD------------ 919
           EIRSFMGKVTYSG+  Y       G +     I  +  + NES+ +              
Sbjct: 620 EIRSFMGKVTYSGESGY-------GLSHHPAYIPSRLHEMNESKNMEVEYDEDEDSEEGA 672

Query: 920 ---ETEDTFIPQDFRKSPSEIENGSPISYSLKTKGDQEIINNNTSSAADAIT 968
              E  D   P + ++SP      SP  Y LK +  QE++NNNT+     I+
Sbjct: 673 SPLEETDGLSPIEAKESP------SPSQYDLKLREKQELLNNNTAEPVIEIS 718




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380029940|ref|XP_003698621.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor hamlet-like [Apis florea] Back     alignment and taxonomy information
>gi|242020553|ref|XP_002430717.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515907|gb|EEB17979.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350427487|ref|XP_003494773.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor hamlet-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711407|ref|XP_003394267.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor hamlet-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345480353|ref|XP_001606323.2| PREDICTED: hypothetical protein LOC100122721 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332030441|gb|EGI70129.1| Ecotropic virus integration site 1 protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|158296910|ref|XP_317239.4| AGAP008232-PA [Anopheles gambiae str. PEST] gi|157014939|gb|EAA43874.4| AGAP008232-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|357610288|gb|EHJ66914.1| hypothetical protein KGM_21146 [Danaus plexippus] Back     alignment and taxonomy information
>gi|270012294|gb|EFA08742.1| hypothetical protein TcasGA2_TC006417 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query971
FB|FBgn0045852990 ham "hamlet" [Drosophila melan 0.182 0.178 0.653 8.5e-113
UNIPROTKB|E1BMZ2 1051 MECOM "Uncharacterized protein 0.179 0.165 0.571 1.1e-111
UNIPROTKB|B7ZRU9 1055 mecom-a "MDS1 and EVI1 complex 0.346 0.318 0.404 1.7e-111
UNIPROTKB|E2RJB2 1042 MECOM "Uncharacterized protein 0.179 0.166 0.571 1.9e-111
UNIPROTKB|B7ZRM8 1050 mecom-b "MDS1 and EVI1 complex 0.333 0.308 0.418 2e-111
UNIPROTKB|E7EUL6 1003 MECOM "MDS1 and EVI1 complex l 0.179 0.173 0.571 3.7e-111
UNIPROTKB|Q03112 1051 MECOM "MDS1 and EVI1 complex l 0.179 0.165 0.571 5.1e-111
UNIPROTKB|E1BXX4 1043 MECOM "Uncharacterized protein 0.179 0.166 0.566 6.9e-111
UNIPROTKB|E7EQ57 1230 MECOM "MDS1 and EVI1 complex l 0.179 0.141 0.571 6.4e-110
UNIPROTKB|F1P809 1114 MECOM "Uncharacterized protein 0.179 0.156 0.571 7.1e-107
FB|FBgn0045852 ham "hamlet" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 631 (227.2 bits), Expect = 8.5e-113, Sum P(4) = 8.5e-113
 Identities = 119/182 (65%), Positives = 136/182 (74%)

Query:   186 HLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHG--RKFPCENCTKVFSDPSNLQRH 243
             HLI  H +  D++ C+ C+  FC RP L  H+A  H   RK+ CENC+KVF DPSNLQRH
Sbjct:   239 HLIGAHHFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSKVFCDPSNLQRH 298

Query:   244 IRTHHVGARQHACQECGKTFATSSGLKQHTHIHSSVKPFRCEVCHKAYTQFSNLCRHKRM 303
             IR +HVGAR H C ECGKTF TSSGLKQH HIHSSVKPF CEVC KAYTQFSNLCRHKRM
Sbjct:   299 IRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRM 358

Query:   304 HANCRMQIKCVKCDQSFSTVTSLSKHKRFCDSTTPGTTPSGQ-NSLSAMSHQTPGIPN-P 361
             HA CRMQIKC KC+QSFST+TSL+KHK+FCDST PG   +   N      HQ P +P+ P
Sbjct:   359 HATCRMQIKCDKCNQSFSTLTSLTKHKKFCDSTGPGPYRNQHVNRHHQHPHQHP-LPHQP 417

Query:   362 YL 363
             +L
Sbjct:   418 HL 419


GO:0048814 "regulation of dendrite morphogenesis" evidence=IMP
GO:0005634 "nucleus" evidence=IDA;TAS
GO:0007423 "sensory organ development" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IMP;NAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0048813 "dendrite morphogenesis" evidence=TAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0048666 "neuron development" evidence=IMP
UNIPROTKB|E1BMZ2 MECOM "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZRU9 mecom-a "MDS1 and EVI1 complex locus protein EVI1-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJB2 MECOM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZRM8 mecom-b "MDS1 and EVI1 complex locus protein EVI1-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E7EUL6 MECOM "MDS1 and EVI1 complex locus protein MDS1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q03112 MECOM "MDS1 and EVI1 complex locus protein EVI1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXX4 MECOM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E7EQ57 MECOM "MDS1 and EVI1 complex locus protein MDS1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P809 MECOM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query971
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 4e-06
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 4e-06
pfam0009622 pfam00096, zf-C2H2, Zinc finger, C2H2 type 2e-04
pfam0009622 pfam00096, zf-C2H2, Zinc finger, C2H2 type 2e-04
pfam0009622 pfam00096, zf-C2H2, Zinc finger, C2H2 type 4e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 6e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 6e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.001
pfam1389424 pfam13894, zf-C2H2_4, C2H2-type zinc finger 0.001
smart0035523 smart00355, ZnF_C2H2, zinc finger 0.001
smart0035523 smart00355, ZnF_C2H2, zinc finger 0.001
smart0035523 smart00355, ZnF_C2H2, zinc finger 0.003
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 43.9 bits (104), Expect = 4e-06
 Identities = 18/25 (72%), Positives = 21/25 (84%)

Query: 46 NLTRHLRTHTGEQPYKCKYCERSFS 70
          NL RH+RTHTGE+PYKC  C +SFS
Sbjct: 1  NLRRHMRTHTGEKPYKCPVCGKSFS 25


Length = 26

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|200998 pfam00096, zf-C2H2, Zinc finger, C2H2 type Back     alignment and domain information
>gnl|CDD|200998 pfam00096, zf-C2H2, Zinc finger, C2H2 type Back     alignment and domain information
>gnl|CDD|200998 pfam00096, zf-C2H2, Zinc finger, C2H2 type Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|206065 pfam13894, zf-C2H2_4, C2H2-type zinc finger Back     alignment and domain information
>gnl|CDD|197676 smart00355, ZnF_C2H2, zinc finger Back     alignment and domain information
>gnl|CDD|197676 smart00355, ZnF_C2H2, zinc finger Back     alignment and domain information
>gnl|CDD|197676 smart00355, ZnF_C2H2, zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 971
KOG1074|consensus958 99.98
KOG3623|consensus1007 99.98
KOG1074|consensus958 99.94
KOG3608|consensus467 99.92
KOG2462|consensus279 99.89
KOG3608|consensus467 99.87
KOG2462|consensus279 99.87
KOG3623|consensus1007 99.85
KOG3576|consensus267 99.59
KOG3576|consensus267 99.56
PHA00733128 hypothetical protein 99.05
PLN03086567 PRLI-interacting factor K; Provisional 98.97
PLN03086567 PRLI-interacting factor K; Provisional 98.94
PHA0276855 hypothetical protein; Provisional 98.92
PHA0276855 hypothetical protein; Provisional 98.87
PHA00733128 hypothetical protein 98.81
KOG3993|consensus500 98.75
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.69
KOG3993|consensus500 98.56
KOG1146|consensus1406 98.41
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.41
PHA0061644 hypothetical protein 98.22
PHA0073279 hypothetical protein 98.2
PHA0061644 hypothetical protein 98.13
PHA0073279 hypothetical protein 97.98
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.93
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.87
KOG2231|consensus669 97.66
COG5189423 SFP1 Putative transcriptional repressor regulating 97.58
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.49
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.47
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.12
COG5189423 SFP1 Putative transcriptional repressor regulating 97.07
KOG1146|consensus1406 97.04
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.96
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.93
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.75
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.75
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.73
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.42
PRK04860160 hypothetical protein; Provisional 96.14
KOG2231|consensus669 96.01
PRK04860160 hypothetical protein; Provisional 95.93
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.91
smart0035526 ZnF_C2H2 zinc finger. 95.71
smart0035526 ZnF_C2H2 zinc finger. 95.71
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.65
KOG2482|consensus423 95.53
COG5236493 Uncharacterized conserved protein, contains RING Z 95.51
KOG2785|consensus390 95.48
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.37
KOG2785|consensus390 95.29
KOG2893|consensus341 95.19
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.02
KOG2482|consensus423 95.0
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 94.9
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.58
COG5236493 Uncharacterized conserved protein, contains RING Z 94.1
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.3
COG5048467 FOG: Zn-finger [General function prediction only] 93.22
COG5048467 FOG: Zn-finger [General function prediction only] 93.13
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.1
KOG4173|consensus253 92.38
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.22
KOG2893|consensus341 91.77
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 89.43
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 89.21
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 87.52
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 86.99
KOG4173|consensus253 86.29
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 84.21
COG404965 Uncharacterized protein containing archaeal-type C 83.62
COG404965 Uncharacterized protein containing archaeal-type C 82.1
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 81.9
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 81.35
>KOG1074|consensus Back     alignment and domain information
Probab=99.98  E-value=9.6e-33  Score=300.31  Aligned_cols=58  Identities=41%  Similarity=0.848  Sum_probs=52.8

Q ss_pred             CCcccCCCCCccCChhhHHHHHHhhcCCCccccCCCCCccccchhhhhhhhhccCCCCC
Q psy14939        761 DRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKP  819 (971)
Q Consensus       761 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  819 (971)
                      .++.|.+||+.|....+|+.|+|+|+|+|||.|.+|+++|..+.+|+.||. +|....+
T Consensus       878 n~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMg-tH~w~q~  935 (958)
T KOG1074|consen  878 NAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMG-THMWVQP  935 (958)
T ss_pred             chhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhc-cccccCC
Confidence            357899999999999999999999999999999999999999999999999 6765544



>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query971
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 9e-18
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 9e-18
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-17
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-16
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-14
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-14
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-14
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-14
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-14
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-14
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 6e-14
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 6e-14
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 9e-14
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 9e-14
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-13
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-13
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-13
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-13
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-13
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-13
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-13
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-13
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-13
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-13
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-13
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-13
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-13
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-13
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-13
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-13
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-12
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-12
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-12
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-12
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-11
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-11
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 7e-10
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 7e-10
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-09
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-08
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-08
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 4e-06
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-08
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 4e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 4e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 4e-05
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 6e-08
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 6e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 9e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 9e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 9e-08
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 9e-08
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-07
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-07
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 3e-04
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 2e-06
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 2e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 5e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 5e-06
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 5e-06
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 5e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 7e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 7e-06
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 1e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 1e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 1e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 1e-05
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-05
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-05
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 4e-05
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 4e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Iteration: 1

Score = 89.4 bits (220), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 1/81 (1%) Query: 32 YACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKC 91 Y C CGK F +S+NL +H RTHTGE+PYKC C +SFS SS+LQ+H R H EKP+KC Sbjct: 5 YKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQR-THTGEKPYKC 63 Query: 92 PLCDRCFGQQTNLDRHLKKHE 112 P C + F + +L RH + H+ Sbjct: 64 PECGKSFSRSDHLSRHQRTHQ 84
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query971
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-31
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-31
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-24
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-24
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-23
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-21
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-20
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-19
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-30
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-30
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-30
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-30
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-22
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-30
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-30
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-21
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-21
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-15
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-15
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-30
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-28
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-28
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-28
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-28
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-27
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-27
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-26
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-25
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-19
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-19
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-16
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-29
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-29
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-22
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-17
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-15
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-15
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-29
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-29
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-23
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-29
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-26
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-26
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-24
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-17
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-17
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-11
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-28
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-28
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-24
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-21
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-19
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-28
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-28
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-21
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-18
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-18
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-18
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-28
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-28
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-26
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-26
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-24
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-16
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-28
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-28
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-28
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-28
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-27
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-25
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-28
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-28
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-17
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-28
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-26
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-26
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-27
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-27
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-20
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-20
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-27
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-27
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-20
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-19
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-26
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-26
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-16
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-25
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-21
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-21
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-24
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-24
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-24
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-24
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-22
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-20
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-23
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-23
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-23
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-23
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-22
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-22
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-21
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-21
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-22
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-22
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-20
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-20
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-22
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-22
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-19
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-19
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 8e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-17
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-17
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-15
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-15
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-17
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-17
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-15
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-15
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-15
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-15
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-10
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-15
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-15
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-15
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-15
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-15
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-15
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-15
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-15
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-14
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-14
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-14
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-14
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-14
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-14
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-14
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-14
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-14
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-14
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-11
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-11
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-14
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-14
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-14
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-14
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-14
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-14
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-14
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-14
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-14
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-14
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-14
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-14
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-14
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-14
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-14
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-13
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-13
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-13
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-13
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 6e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-11
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-11
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 9e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 9e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-08
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 8e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-09
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-09
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-09
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-09
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-07
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-07
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 7e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 7e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 9e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 9e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 8e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 8e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 8e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 8e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 3e-06
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 3e-06
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 4e-06
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 4e-06
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 1e-04
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 5e-04
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 5e-04
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
 Score =  115 bits (292), Expect = 6e-31
 Identities = 35/80 (43%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 32  YACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKC 91
           + C+ CGK F R   L  H+R HTG +PYKCK C+ + + SS+L +H+R IH+ E+PFKC
Sbjct: 9   HKCEVCGKCFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLR-IHSDERPFKC 67

Query: 92  PLCDRCFGQQTNLDRHLKKH 111
            +C       + L  HL+ H
Sbjct: 68  QICPYASRNSSQLTVHLRSH 87


>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query971
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.94
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.86
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.82
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.81
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.8
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.79
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.75
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.75
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.75
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.74
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.72
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.72
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.72
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.71
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.71
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.71
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.69
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.68
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.67
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.67
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.66
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.66
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.66
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.66
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.66
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.65
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.65
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.61
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.6
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.6
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.58
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.58
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.57
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.56
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.55
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.55
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.53
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.53
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.49
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.48
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.48
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.47
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.47
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.45
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.45
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.44
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.44
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.43
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.43
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.41
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.41
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.4
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.39
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.38
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.37
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.34
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.33
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.33
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.32
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.31
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.31
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.29
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.29
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.29
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.28
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.28
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.26
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.25
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.2
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.2
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.2
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.19
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.19
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.19
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.17
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.17
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.16
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.16
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.1
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.1
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.03
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.99
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.99
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.97
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.94
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.93
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.93
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.91
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.91
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.9
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.9
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.89
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.88
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.87
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.87
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.87
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.87
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.85
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.85
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.83
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.79
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.77
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.77
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.77
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.75
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.73
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.73
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.73
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.71
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.7
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.68
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.68
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.68
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.67
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.67
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.66
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.66
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.66
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.65
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.64
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.64
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.63
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.63
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.63
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.63
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.62
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.62
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.61
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.61
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.6
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.59
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.58
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.56
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.49
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.47
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.46
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.41
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.4
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.39
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.38
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.37
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.37
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.3
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.21
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.21
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.18
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.17
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.07
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.07
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.06
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.04
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.03
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.02
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.01
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.0
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.0
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.97
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.96
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.94
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.94
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.94
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.93
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.16
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.92
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.15
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.91
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.9
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.89
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.89
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.88
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.88
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.87
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.84
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.84
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.83
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.83
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.83
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.82
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.82
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.81
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.79
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.78
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.96
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.95
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.72
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.85
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.63
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.79
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.62
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.44
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.37
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.24
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.32
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.18
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.52
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.45
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.38
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.02
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.82
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 92.72
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 90.71
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 85.74
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 83.44
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 81.11
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.97  E-value=4.1e-31  Score=264.19  Aligned_cols=183  Identities=41%  Similarity=0.819  Sum_probs=94.9

Q ss_pred             cccccCCCCCCCCCceeccccccccCChHHHHHHHHHhcCCcceeccccccccCCHHHHHHHHHhhcCCCCCeecCCCCc
Q psy14939         17 NNAVNGSSSKTTKDRYACKYCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDR   96 (971)
Q Consensus        17 ~~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~k~~~C~~C~~   96 (971)
                      ..+..+...+.++++|.|..|++.|.+...|..|++.|+++++|.|.+|++.|.....|..|++ .|.++++|.|.+|++
T Consensus         7 ~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~   85 (190)
T 2i13_A            7 SSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQR-THTGEKPYKCPECGK   85 (190)
T ss_dssp             ------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHH-HHHCCCCEECTTTCC
T ss_pred             ccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHH-hcCCCCCccCcccCC
Confidence            3444455566667777777777777777777777777777777777777777777777777776 566677777777777


Q ss_pred             ccCchhhHHHHHhhhhccCCCCccccCCCCCCcccchhhhhhHHHHhhhcCCccccCCcccccccccCCCCCCCCCCcCC
Q psy14939         97 CFGQQTNLDRHLKKHEADDGSGLVSMADSPESSNENEREDAYFDEIRSFMGKVTYSGDVAYNQENLYTGNNPPSPLIDVK  176 (971)
Q Consensus        97 ~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  176 (971)
                      .|.....|..|++.|++.                                                              
T Consensus        86 ~f~~~~~l~~H~~~h~~~--------------------------------------------------------------  103 (190)
T 2i13_A           86 SFSQRANLRAHQRTHTGE--------------------------------------------------------------  103 (190)
T ss_dssp             EESCHHHHHHHHHHHHTC--------------------------------------------------------------
T ss_pred             ccCCHHHHHHHHHhcCCC--------------------------------------------------------------
Confidence            777777777777766532                                                              


Q ss_pred             CCChHHHHHHHhhcCCCCCCCcccCccchhccChhHHHhhHhhcCC-CCcccCCCCCccCChhHHHhhHhhhccCCcccc
Q psy14939        177 DDDDNELEDHLITGHRYPPDQYRCESCSQTFCWRPHLNFHQAQVHG-RKFPCENCTKVFSDPSNLQRHIRTHHVGARQHA  255 (971)
Q Consensus       177 ~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~~~-~~~~C~~C~~~f~~~~~L~~H~~~hh~~~~~~~  255 (971)
                                         .+|.|..|++.|.....|..|++.|++ ++|.|..|++.|.....|..|+++| .++++|.
T Consensus       104 -------------------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H-~~~~~~~  163 (190)
T 2i13_A          104 -------------------KPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTH-TGEKPYK  163 (190)
T ss_dssp             -------------------CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHH-HCCCCEE
T ss_pred             -------------------CCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhc-CCCCCeE
Confidence                               125555555555555555555555544 3455555555555555555555555 3455555


Q ss_pred             cCcCCCccCChHHHhhCccccCCCCcc
Q psy14939        256 CQECGKTFATSSGLKQHTHIHSSVKPF  282 (971)
Q Consensus       256 C~~C~~~f~~~~~l~~H~~~h~~~~~~  282 (971)
                      |.+|++.|.....|..|+++|++++||
T Consensus       164 C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          164 CPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             CTTTCCEESSHHHHHHHHTTC------
T ss_pred             CCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            555555555555555555555555443



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 971
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-12
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-12
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-12
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-12
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-11
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-11
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.004
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 9e-11
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 9e-11
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-10
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-10
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-08
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-08
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.004
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 9e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 9e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 3e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.004
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 3e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 3e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 6e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 5e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 5e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.004
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.004
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-06
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-06
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 8e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 8e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 7e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 7e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 7e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.001
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 1e-04
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 0.003
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 0.003
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 4e-04
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 4e-04
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 0.002
d2drpa137 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-f 0.001
d1klra_30 g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 96 0.004
d1klra_30 g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 96 0.004
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.0 bits (146), Expect = 2e-12
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 52 RTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKE 86
          RTH+GE+PY+C  C   F+ S  ++ H+   H + 
Sbjct: 1  RTHSGEKPYECYICHARFTQSGTMKMHILQKHTEN 35


>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Length = 37 Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query971
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.58
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.56
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.24
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.2
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.16
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.15
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.14
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.1
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.06
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.04
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.04
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.03
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.02
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.01
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.99
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.98
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.98
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.97
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.95
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.93
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.9
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.88
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.83
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.77
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.76
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.71
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.71
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.64
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.64
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.6
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.6
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.59
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.57
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.56
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.51
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.5
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.5
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.46
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.44
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.31
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.3
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.03
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.81
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.74
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.74
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.72
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.71
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.69
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.68
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.64
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.59
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.57
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.4
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.38
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.33
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.27
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.26
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.25
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.25
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.25
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.21
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.2
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.16
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.12
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.08
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.07
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.02
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.99
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.96
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.88
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.87
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.86
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.84
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.64
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.38
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.36
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.36
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.18
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.01
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.94
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.85
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.82
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.79
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.75
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.09
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.76
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.66
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.52
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.46
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.1
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.36
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.13
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.95
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.82
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.04
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.67
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 91.35
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.88
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.37
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.03
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.37
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.11
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.05
d1y0jb136 U-shaped transcription factor, different fingers { 85.71
d1y0jb136 U-shaped transcription factor, different fingers { 85.56
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 85.43
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.42
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.15
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 84.09
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 83.94
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 83.56
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 83.43
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 83.29
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 81.68
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 81.47
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.58  E-value=2.9e-16  Score=115.41  Aligned_cols=53  Identities=32%  Similarity=0.756  Sum_probs=27.3

Q ss_pred             CCccccCCCCCccccchhhhhhhhhccCCCCCccCCCCCcccCChhHHHHHHhhh
Q psy14939        788 EQPYKCKYCERSFSISSNLQRHVRNIHNKEKPFKCPLCDRCFGQQTNLDRHLKKH  842 (971)
Q Consensus       788 ~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  842 (971)
                      ||||+|+ ||++|+++..|.+|++ +|++++||.|.+|+++|.....|.+||++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~-~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMS-MHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHH-HHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhh-ccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            3455553 5555555555555554 455555555555555555555555555443



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure