Diaphorina citri psyllid: psy14943


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MFPVVKVSIKGLEPDAMYTVLLEFLQIEQKSVAMSIEMIKSDSQQYEAYGNPQVILEDLDLWLKFQSHTNEMIVTKNGRRMFPVVKVSIKGLEPDAMYTVLLEFLQIEQKRWKYVNGEWVPAGKPEQPPMNAMYLHPESPNFGEHWMKDCVSFAKVKLTNHSNGSGQIMLNSLHKYEPRIHLVKVATEQQIIKTFPFPETQFIAVTAYQNEEFIAVTAYQNEEVTSLKIKFNPFAKAFLDAKEKTDNYYNQQTTNEWKYVNGEWVPAGKPEQPPMNAMYLHPESPNFGEHWMKDCVSFAKVKLTNHSNGSGQSGMGTQGPVTLEVRHT
ccccccccccccccccccccHHHHHHccccccccccccccccccccccccccEEEEccHHHHHHHHccccEEEEcccccccccccEEEEEcccccccEEEEEEEEEcccccEEEEcccEEEccccccccccccEEcccccccHHHHHcccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccEEEEEEEccEEEEEEcccccccHHcccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccEEccEEEcccccccccccccccccEECccccc
MF*VVKVSIKGLEPDAMYTVLLEFLQI*******S*************YGNPQVILEDLDLWLKFQSHTNEMIVTKNGRRMFPVVKVSIKGLEPDAMYTVLLEFLQIEQKRWKYVNGEWVPAGKPEQPPMNAMYLHPESPNFGEHWMKDCVSFAKVKLTNHSNGSGQIMLNSLHKYEPRIHLVKVATEQQIIKTFPFPETQFIAVTAYQNEEFIAVTAYQNEEVTSLKIKFNPFAKAFLDAKEKTDNYYNQQTTNEWKYVNGEWVP*******************NFGEHWMKDCVSFAKVKLTNH*********GTQGPVTLEVR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPVVKVSIKGLEPDAMYTVLLEFLQIEQKSVAMSIEMIKSDSQQYEAYGNPQVILEDLDLWLKFQSHTNEMIVTKNGRRMFPVVKVSIKGLEPDAMYTVLLEFLQIEQKRWKYVNGEWVPAGKPEQPPMNAMYLHPESPNFGEHWMKDCVSFAKVKLTNHSNGSGQIMLNSLHKYEPRIHLVKVATEQQIIKTFPFPETQFIAVTAYQNEEFIAVTAYQNEEVTSLKIKFNPFAKAFLDAKEKTDNYYNQQTTNEWKYVNGEWVPAGKPEQPPMNAMYLHPESPNFGEHWMKDCVSFAKVKLTNHSNGSGQSGMGTQGPVTLEVRHT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Brachyury protein Involved in the transcriptional regulation of genes required for mesoderm formation and differentiation. Binds to a palindromic site (called T site) and activates gene transcription when bound to such a site.confidentQ9GL27
T-related protein Required for the specification of the hindgut and anal pads.confidentP55965
Brachyury protein homolog 1 Involved in the transcriptional regulation of genes required for mesoderm formation and differentiation.confidentQ17134

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001756 [BP]somitogenesisprobableGO:0032502, GO:0007389, GO:0044699, GO:0032501, GO:0009952, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0003002, GO:0043009, GO:0009653, GO:0035282, GO:0048646, GO:0061053
GO:0003257 [BP]positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiationprobableGO:0051252, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0030154, GO:0031323, GO:0051254, GO:0061061, GO:0072359, GO:0072358, GO:0010628, GO:0010002, GO:0051146, GO:0045445, GO:0010556, GO:0007275, GO:0044699, GO:1901228, GO:0048863, GO:0010604, GO:0048869, GO:0051171, GO:0055007, GO:2000112, GO:0050789, GO:0019219, GO:0048513, GO:0065007, GO:0048518, GO:0044763, GO:0010468, GO:0032502, GO:0032501, GO:0045935, GO:0060379, GO:0060255, GO:0009889, GO:0009987, GO:0035051, GO:0009888, GO:0050794, GO:0044767, GO:0008150, GO:0045893, GO:2001141, GO:0009891, GO:1901213, GO:0080090, GO:0007507, GO:0044707, GO:0051173, GO:0048856, GO:0003256, GO:0014706, GO:0048738, GO:0006355, GO:0010557, GO:0006357, GO:0045944, GO:0060537, GO:0048731, GO:0042692, GO:0048522
GO:0060070 [BP]canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0000978 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0010171 [BP]body morphogenesisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0060395 [BP]SMAD protein signal transductionprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699, GO:0007178
GO:0019953 [BP]sexual reproductionprobableGO:0008150, GO:0000003
GO:0048609 [BP]multicellular organismal reproductive processprobableGO:0022414, GO:0032501, GO:0008150, GO:0000003, GO:0032504
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0007509 [BP]mesoderm migration involved in gastrulationprobableGO:0032502, GO:0048598, GO:0032501, GO:0048332, GO:0001704, GO:0007498, GO:0007369, GO:0048856, GO:0009888, GO:0007275, GO:0044767, GO:0009790, GO:0009653, GO:0008150, GO:0048646, GO:0048729, GO:0090130, GO:0044707, GO:0044699, GO:0001707
GO:0030509 [BP]BMP signaling pathwayprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0007178, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0003007 [BP]heart morphogenesisprobableGO:0032502, GO:0007507, GO:0009887, GO:0032501, GO:0044707, GO:0048513, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0044702 [BP]single organism reproductive processprobableGO:0022414, GO:0008150, GO:0000003, GO:0044699
GO:0022603 [BP]regulation of anatomical structure morphogenesisprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0060562 [BP]epithelial tube morphogenesisprobableGO:0032502, GO:0002009, GO:0048856, GO:0035239, GO:0044707, GO:0060429, GO:0009888, GO:0044767, GO:0032501, GO:0008150, GO:0048729, GO:0035295, GO:0009653, GO:0007275, GO:0044699
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0030903 [BP]notochord developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048568, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0023019 [BP]signal transduction involved in regulation of gene expressionprobableGO:0044700, GO:0051716, GO:0019222, GO:0008150, GO:0060255, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0010468, GO:0044699
GO:0000980 [MF]RNA polymerase II distal enhancer sequence-specific DNA bindingprobableGO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0044451 [CC]nucleoplasm partprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0061371 [BP]determination of heart left/right asymmetryprobableGO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0007389, GO:0048513, GO:0007368, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0009855, GO:0009799, GO:0048731, GO:0007275, GO:0044699
GO:0001104 [MF]RNA polymerase II transcription cofactor activityprobableGO:0001076, GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0001102 [MF]RNA polymerase II activating transcription factor bindingprobableGO:0001085, GO:0033613, GO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0001191 [MF]RNA polymerase II transcription factor binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001076, GO:0003674, GO:0000989, GO:0000988
GO:0040007 [BP]growthprobableGO:0008150
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XBR, chain A
Confidence level:very confident
Coverage over the Query: 51-207,219-244
View the alignment between query and template
View the model in PyMOL
Template: 4A04, chain A
Confidence level:very confident
Coverage over the Query: 231-328
View the alignment between query and template
View the model in PyMOL