Diaphorina citri psyllid: psy14950


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNNPR
ccccccccccEEEccccHHHHHHHHccccCCccccccccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccc
MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNNPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001972 [MF]retinoic acid bindingprobableGO:0043168, GO:0031406, GO:0019840, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0033293, GO:0005501
GO:0016020 [CC]membraneprobableGO:0005575
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0004857 [MF]enzyme inhibitor activityprobableGO:0030234, GO:0003674
GO:0034754 [BP]cellular hormone metabolic processprobableGO:0042445, GO:0009987, GO:0044237, GO:0010817, GO:0008150, GO:0008152, GO:0065007, GO:0065008
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:1901361 [BP]organic cyclic compound catabolic processprobableGO:1901575, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:1901360
GO:0052696 [BP]flavonoid glucuronidationprobableGO:0019585, GO:0044238, GO:0044710, GO:0005975, GO:0052695, GO:0006082, GO:0005996, GO:0009987, GO:0009812, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0006063, GO:0008152, GO:0044723, GO:0043436, GO:0044237, GO:0044281
GO:0052697 [BP]xenobiotic glucuronidationprobableGO:0052695, GO:0019752, GO:0006805, GO:0009410, GO:0044281, GO:0070887, GO:0044699, GO:0051716, GO:0071704, GO:0019585, GO:0009987, GO:0044710, GO:0032787, GO:0044763, GO:0008152, GO:0044723, GO:0042221, GO:0044238, GO:0005975, GO:0006082, GO:0005996, GO:0050896, GO:0044237, GO:0071466, GO:0006063, GO:0043436, GO:0008150
GO:0010294 [MF]abscisic acid glucosyltransferase activityprobableGO:0035251, GO:0046527, GO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008194
GO:0051552 [BP]flavone metabolic processprobableGO:0044710, GO:0042440, GO:0009812, GO:0071704, GO:0008150, GO:0008152
GO:0015020 [MF]glucuronosyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008194
GO:0019439 [BP]aromatic compound catabolic processprobableGO:0009987, GO:0006725, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0043086 [BP]negative regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0050789
GO:0008202 [BP]steroid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360
GO:0031324 [BP]negative regulation of cellular metabolic processprobableGO:0009892, GO:0019222, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O6L, chain A
Confidence level:very confident
Coverage over the Query: 3-76
View the alignment between query and template
View the model in PyMOL