Psyllid ID: psy14950


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNNPR
ccccccccccEEEcccHHHHHHHHHHcccEEcccccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHccc
ccccccccEEEEEccccccHHHHHHcccccccccccccccccHEEEEccccEEEEEcccccHHHHHHHHHHHHcccc
mptghrncklfithggihssmeavyhgvpvvmmpgfsdqhqncklmeekgmglitphetitgDILYITIREVLNNPR
MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLitphetitgdilYITIREVLNNPR
MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNNPR
******NCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVL****
MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNN**
MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNNPR
*PTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNNPR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNNPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query77 2.2.26 [Sep-21-2011]
Q64676 541 2-hydroxyacylsphingosine yes N/A 0.948 0.134 0.424 3e-12
Q16880 541 2-hydroxyacylsphingosine yes N/A 0.948 0.134 0.424 4e-12
Q09426 541 2-hydroxyacylsphingosine yes N/A 0.948 0.134 0.424 4e-12
Q22295523 Putative UDP-glucuronosyl yes N/A 0.896 0.131 0.420 5e-12
Q3UP75523 UDP-glucuronosyltransfera no N/A 0.961 0.141 0.405 6e-12
O75795530 UDP-glucuronosyltransfera no N/A 0.948 0.137 0.424 1e-11
P54855530 UDP-glucuronosyltransfera no N/A 0.948 0.137 0.424 1e-11
P19488530 UDP-glucuronosyltransfera no N/A 0.948 0.137 0.397 1e-11
Q8BWQ1534 UDP-glucuronosyltransfera no N/A 0.948 0.136 0.452 4e-11
Q9R110530 UDP-glucuronosyltransfera no N/A 0.948 0.137 0.465 4e-11
>sp|Q64676|CGT_MOUSE 2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Mus musculus GN=Ugt8 PE=2 SV=2 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 47/73 (64%)

Query: 4   GHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGD 63
           GH N + F++HGG++S  E +YHGVPVV +P F D +     ++ KGMG++    T+T  
Sbjct: 348 GHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWNTVTEG 407

Query: 64  ILYITIREVLNNP 76
            LY  + +V+NNP
Sbjct: 408 ELYDALVKVINNP 420




Catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 4EC: 5
>sp|Q16880|CGT_HUMAN 2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Homo sapiens GN=UGT8 PE=2 SV=2 Back     alignment and function description
>sp|Q09426|CGT_RAT 2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Rattus norvegicus GN=Ugt8 PE=2 SV=1 Back     alignment and function description
>sp|Q22295|UGT50_CAEEL Putative UDP-glucuronosyltransferase ugt-50 OS=Caenorhabditis elegans GN=ugt-50 PE=1 SV=2 Back     alignment and function description
>sp|Q3UP75|UD3A1_MOUSE UDP-glucuronosyltransferase 3A1 OS=Mus musculus GN=Ugt3a1 PE=2 SV=1 Back     alignment and function description
>sp|O75795|UDB17_HUMAN UDP-glucuronosyltransferase 2B17 OS=Homo sapiens GN=UGT2B17 PE=2 SV=1 Back     alignment and function description
>sp|P54855|UDB15_HUMAN UDP-glucuronosyltransferase 2B15 OS=Homo sapiens GN=UGT2B15 PE=1 SV=3 Back     alignment and function description
>sp|P19488|UDB37_RAT UDP-glucuronosyltransferase 2B37 OS=Rattus norvegicus GN=Ugt2b37 PE=2 SV=1 Back     alignment and function description
>sp|Q8BWQ1|UD2A3_MOUSE UDP-glucuronosyltransferase 2A3 OS=Mus musculus GN=Ugt2a3 PE=2 SV=1 Back     alignment and function description
>sp|Q9R110|UD2A3_CAVPO UDP-glucuronosyltransferase 2A3 OS=Cavia porcellus GN=UGT2A3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
307202576107 UDP-glucuronosyltransferase 2B1 [Harpegn 0.974 0.700 0.44 2e-13
308475178 535 CRE-UGT-50 protein [Caenorhabditis reman 0.948 0.136 0.438 4e-12
189240668 454 PREDICTED: similar to glucosyl/glucurono 0.961 0.162 0.459 6e-12
156372882 515 predicted protein [Nematostella vectensi 0.948 0.141 0.452 7e-12
193659615 505 PREDICTED: 2-hydroxyacylsphingosine 1-be 0.948 0.144 0.493 9e-12
341890733 503 CBN-UGT-50 protein [Caenorhabditis brenn 0.922 0.141 0.450 1e-11
321455272 421 hypothetical protein DAPPUDRAFT_64677 [D 0.961 0.175 0.432 2e-11
301788017 541 PREDICTED: 2-hydroxyacylsphingosine 1-be 0.948 0.134 0.452 2e-11
270013657 2139 hypothetical protein TcasGA2_TC012284 [T 0.961 0.034 0.459 2e-11
327274196 541 PREDICTED: 2-hydroxyacylsphingosine 1-be 0.948 0.134 0.438 3e-11
>gi|307202576|gb|EFN81911.1| UDP-glucuronosyltransferase 2B1 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 54/75 (72%)

Query: 2  PTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETIT 61
          PTGH N ++FI+HGG+  S+EA Y+GVPV+ +P F+DQ++N  ++  KGMG+   +E ++
Sbjct: 7  PTGHHNTRVFISHGGLMGSLEAFYYGVPVIGIPIFADQYRNVNVLVHKGMGVKLRYENLS 66

Query: 62 GDILYITIREVLNNP 76
           + + + +  VLNNP
Sbjct: 67 EETMNVALSTVLNNP 81




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|308475178|ref|XP_003099808.1| CRE-UGT-50 protein [Caenorhabditis remanei] gi|308266280|gb|EFP10233.1| CRE-UGT-50 protein [Caenorhabditis remanei] Back     alignment and taxonomy information
>gi|189240668|ref|XP_972240.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|156372882|ref|XP_001629264.1| predicted protein [Nematostella vectensis] gi|156216260|gb|EDO37201.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|193659615|ref|XP_001952770.1| PREDICTED: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|341890733|gb|EGT46668.1| CBN-UGT-50 protein [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|321455272|gb|EFX66409.1| hypothetical protein DAPPUDRAFT_64677 [Daphnia pulex] Back     alignment and taxonomy information
>gi|301788017|ref|XP_002929424.1| PREDICTED: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase-like [Ailuropoda melanoleuca] gi|281346557|gb|EFB22141.1| hypothetical protein PANDA_019601 [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|270013657|gb|EFA10105.1| hypothetical protein TcasGA2_TC012284 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|327274196|ref|XP_003221864.1| PREDICTED: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase-like [Anolis carolinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
UNIPROTKB|E2RA42 541 UGT8 "Uncharacterized protein" 0.948 0.134 0.438 9.1e-13
UNIPROTKB|F6RP42 541 UGT8 "Uncharacterized protein" 0.948 0.134 0.438 1.5e-12
UNIPROTKB|F1NH08 537 UGT8 "Uncharacterized protein" 0.948 0.135 0.424 1.9e-12
UNIPROTKB|Q16880 541 UGT8 "2-hydroxyacylsphingosine 0.948 0.134 0.424 2.5e-12
MGI|MGI:109522 541 Ugt8a "UDP galactosyltransfera 0.948 0.134 0.424 2.5e-12
RGD|3938 541 Ugt8 "UDP glycosyltransferase 0.948 0.134 0.424 2.5e-12
RGD|2319314196 LOC100361864 "UDP-glucuronosyl 0.948 0.372 0.397 3.9e-12
MGI|MGI:2146055523 Ugt3a1 "UDP glycosyltransferas 0.948 0.139 0.410 2.2e-11
UNIPROTKB|F1MFF6529 UGT2B10 "Uncharacterized prote 0.948 0.137 0.424 2.8e-11
FB|FBgn0040262523 Ugt36Ba "Ugt36Ba" [Drosophila 0.948 0.139 0.493 3.6e-11
UNIPROTKB|E2RA42 UGT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 178 (67.7 bits), Expect = 9.1e-13, P = 9.1e-13
 Identities = 32/73 (43%), Positives = 48/73 (65%)

Query:     4 GHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGD 63
             GH N K F++HGG++S  E +YHGVPVV +P F D +     ++ KGMG++   +T+T  
Sbjct:   348 GHSNIKAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKTVTEG 407

Query:    64 ILYITIREVLNNP 76
              LY  + +V+NNP
Sbjct:   408 ELYEALVKVINNP 420




GO:0048812 "neuron projection morphogenesis" evidence=IEA
GO:0030913 "paranodal junction assembly" evidence=IEA
GO:0008088 "axon cargo transport" evidence=IEA
GO:0007010 "cytoskeleton organization" evidence=IEA
GO:0002175 "protein localization to paranode region of axon" evidence=IEA
GO:0016758 "transferase activity, transferring hexosyl groups" evidence=IEA
UNIPROTKB|F6RP42 UGT8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH08 UGT8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q16880 UGT8 "2-hydroxyacylsphingosine 1-beta-galactosyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:109522 Ugt8a "UDP galactosyltransferase 8A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3938 Ugt8 "UDP glycosyltransferase 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2319314 LOC100361864 "UDP-glucuronosyltransferase 2B3-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2146055 Ugt3a1 "UDP glycosyltransferases 3 family, polypeptide A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFF6 UGT2B10 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0040262 Ugt36Ba "Ugt36Ba" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 3e-18
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 4e-14
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 5e-14
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 6e-13
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 2e-11
PLN02152455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 4e-09
PLN02173449 PLN02173, PLN02173, UDP-glucosyl transferase famil 6e-07
PLN02448459 PLN02448, PLN02448, UDP-glycosyltransferase family 7e-07
PLN02210456 PLN02210, PLN02210, UDP-glucosyl transferase 8e-07
PLN02555480 PLN02555, PLN02555, limonoid glucosyltransferase 1e-06
PLN00164480 PLN00164, PLN00164, glucosyltransferase; Provision 2e-06
PLN02992481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 1e-05
PLN03015470 PLN03015, PLN03015, UDP-glucosyl transferase 3e-05
PLN02534491 PLN02534, PLN02534, UDP-glycosyltransferase 3e-05
TIGR00661321 TIGR00661, MJ1255, conserved hypothetical protein 6e-05
PLN02554481 PLN02554, PLN02554, UDP-glycosyltransferase family 9e-05
pfam13528317 pfam13528, Glyco_trans_1_3, Glycosyl transferase f 9e-05
COG0707357 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acety 2e-04
PLN02207468 PLN02207, PLN02207, UDP-glycosyltransferase 4e-04
PLN03004451 PLN03004, PLN03004, UDP-glycosyltransferase 6e-04
TIGR01133348 TIGR01133, murG, undecaprenyldiphospho-muramoylpen 0.001
PLN02670472 PLN02670, PLN02670, transferase, transferring glyc 0.002
PLN02863477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 0.003
PLN02410451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 0.004
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
 Score = 76.7 bits (189), Expect = 3e-18
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 4   GHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGD 63
           GH   + F+TH G +   EA+ HGVP+V MP F DQ  N K ME KG  +     T+T +
Sbjct: 338 GHPKTRAFVTHAGSNGVYEAICHGVPMVGMPLFGDQMDNAKHMEAKGAAVTLNVLTMTSE 397

Query: 64  ILYITIREVLNNP 76
            L   ++ V+N+P
Sbjct: 398 DLLNALKTVINDP 410


Length = 500

>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|178589 PLN03015, PLN03015, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|233077 TIGR00661, MJ1255, conserved hypothetical protein Back     alignment and domain information
>gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|222200 pfam13528, Glyco_trans_1_3, Glycosyl transferase family 1 Back     alignment and domain information
>gnl|CDD|223779 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|233284 TIGR01133, murG, undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 77
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 99.91
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 99.9
PLN02208442 glycosyltransferase family protein 99.89
PLN02670472 transferase, transferring glycosyl groups 99.88
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.88
PLN02210456 UDP-glucosyl transferase 99.87
PLN02555480 limonoid glucosyltransferase 99.87
PLN02554481 UDP-glycosyltransferase family protein 99.87
PLN00414446 glycosyltransferase family protein 99.86
PLN02992481 coniferyl-alcohol glucosyltransferase 99.86
PLN02764453 glycosyltransferase family protein 99.86
PLN02173449 UDP-glucosyl transferase family protein 99.86
PLN03004451 UDP-glycosyltransferase 99.86
PLN02167475 UDP-glycosyltransferase family protein 99.86
PLN00164480 glucosyltransferase; Provisional 99.86
PLN02448459 UDP-glycosyltransferase family protein 99.85
PLN02207468 UDP-glycosyltransferase 99.85
PLN02562448 UDP-glycosyltransferase 99.85
PLN02152455 indole-3-acetate beta-glucosyltransferase 99.84
PLN03007482 UDP-glucosyltransferase family protein 99.83
PLN03015470 UDP-glucosyl transferase 99.82
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.82
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.82
KOG1192|consensus496 99.81
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 99.79
PLN02534491 UDP-glycosyltransferase 99.78
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 99.75
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.71
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 99.69
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.63
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.6
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.58
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.39
COG4671400 Predicted glycosyl transferase [General function p 99.26
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.2
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.19
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.11
KOG3349|consensus170 99.07
PLN02605382 monogalactosyldiacylglycerol synthase 98.89
PRK13609380 diacylglycerol glucosyltransferase; Provisional 98.87
TIGR03492396 conserved hypothetical protein. This protein famil 98.83
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 98.79
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.61
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 98.53
COG5017161 Uncharacterized conserved protein [Function unknow 98.47
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 98.27
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 97.94
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 97.91
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 97.89
PRK14089347 ipid-A-disaccharide synthase; Provisional 97.85
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 97.67
cd03814364 GT1_like_2 This family is most closely related to 97.65
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 97.36
cd03801374 GT1_YqgM_like This family is most closely related 97.29
cd03823359 GT1_ExpE7_like This family is most closely related 97.29
cd03820348 GT1_amsD_like This family is most closely related 97.26
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 97.23
cd03808359 GT1_cap1E_like This family is most closely related 97.16
cd03794394 GT1_wbuB_like This family is most closely related 97.14
cd03798377 GT1_wlbH_like This family is most closely related 97.08
cd03795357 GT1_like_4 This family is most closely related to 97.05
cd03807365 GT1_WbnK_like This family is most closely related 97.03
cd03817374 GT1_UGDG_like This family is most closely related 96.99
cd03800398 GT1_Sucrose_synthase This family is most closely r 96.89
cd04946407 GT1_AmsK_like This family is most closely related 96.77
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 96.7
cd03822366 GT1_ecORF704_like This family is most closely rela 96.61
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 96.56
cd03821375 GT1_Bme6_like This family is most closely related 96.55
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 96.55
cd03812358 GT1_CapH_like This family is most closely related 96.54
cd04951360 GT1_WbdM_like This family is most closely related 96.48
cd03825365 GT1_wcfI_like This family is most closely related 96.46
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 96.44
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 96.42
cd04962371 GT1_like_5 This family is most closely related to 96.39
cd03816415 GT1_ALG1_like This family is most closely related 96.28
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 96.26
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 96.24
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 96.17
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 96.01
cd03811353 GT1_WabH_like This family is most closely related 95.98
PLN02275371 transferase, transferring glycosyl groups 95.96
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 95.93
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 95.92
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 95.88
cd04949372 GT1_gtfA_like This family is most closely related 95.69
cd03818396 GT1_ExpC_like This family is most closely related 95.67
cd03805392 GT1_ALG2_like This family is most closely related 95.63
cd03804351 GT1_wbaZ_like This family is most closely related 95.61
cd03819355 GT1_WavL_like This family is most closely related 95.57
cd03813475 GT1_like_3 This family is most closely related to 95.19
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 95.01
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 94.96
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 94.91
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 94.8
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 94.77
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 94.56
PRK04885 265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 94.46
PRK10017426 colanic acid biosynthesis protein; Provisional 94.07
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 94.05
PRK02649 305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 93.9
cd03796398 GT1_PIG-A_like This family is most closely related 93.86
PRK10307412 putative glycosyl transferase; Provisional 93.86
PRK02155 291 ppnK NAD(+)/NADH kinase family protein; Provisiona 93.72
PLN02846462 digalactosyldiacylglycerol synthase 93.68
PRK14077 287 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 93.53
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 93.51
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 93.29
PLN02501 794 digalactosyldiacylglycerol synthase 93.05
PRK01911 292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 92.88
PRK03372 306 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 92.77
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 92.77
cd03809365 GT1_mtfB_like This family is most closely related 92.7
PHA01633335 putative glycosyl transferase group 1 92.69
PRK03708 277 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 92.62
PRK04539 296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 92.55
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 92.22
PRK03501 264 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 92.09
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 92.03
cd04955363 GT1_like_6 This family is most closely related to 91.95
PRK14075 256 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 91.92
PRK01185 271 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 91.78
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 91.68
PRK03378 292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 91.43
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 91.11
PRK14076 569 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 90.85
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 90.59
cd03802335 GT1_AviGT4_like This family is most closely relate 90.25
PLN02929 301 NADH kinase 90.11
PHA01630331 putative group 1 glycosyl transferase 89.81
PRK01231 295 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 89.74
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 89.61
PLN02935 508 Bifunctional NADH kinase/NAD(+) kinase 89.61
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 89.28
PF07429360 Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc 88.09
TIGR02470784 sucr_synth sucrose synthase. This model represents 87.49
PF06506176 PrpR_N: Propionate catabolism activator; InterPro: 87.45
PLN00142815 sucrose synthase 87.33
PRK02231 272 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 87.29
cd03806419 GT1_ALG11_like This family is most closely related 87.18
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 87.13
PLN02727 986 NAD kinase 86.03
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 85.17
KOG4180|consensus 395 85.07
PRK00654466 glgA glycogen synthase; Provisional 84.82
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 84.75
PRK02797322 4-alpha-L-fucosyltransferase; Provisional 84.69
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 84.35
COG3660329 Predicted nucleoside-diphosphate-sugar epimerase [ 83.83
PRK14098489 glycogen synthase; Provisional 83.62
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 83.01
PF11071141 DUF2872: Protein of unknown function (DUF2872); In 82.64
KOG4626|consensus966 82.17
COG4370412 Uncharacterized protein conserved in bacteria [Fun 81.51
PRK06270 341 homoserine dehydrogenase; Provisional 80.49
PRK10125405 putative glycosyl transferase; Provisional 80.22
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
Probab=99.91  E-value=5.5e-25  Score=144.72  Aligned_cols=76  Identities=47%  Similarity=0.777  Sum_probs=67.5

Q ss_pred             CCCCCCccceEEecCChHHHHHHHHcCCCEEEeCCCCChHHHHHHHHHhCceeeeCCCCCCHHHHHHHHHHHHcCC
Q psy14950          1 MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNNP   76 (77)
Q Consensus         1 ~~l~~~~~~~~i~h~G~~t~~e~l~~g~P~i~~P~~~~q~~na~~~~~~g~g~~~~~~~~~~~~l~~~i~~~l~~~   76 (77)
                      ++|+||++++||||||+||+.|++++|+|+|++|.++||..||.++++.|+|+.++.++++.+++.++++++++|+
T Consensus       335 ~lL~hp~v~~fitHgG~~s~~Ea~~~gvP~l~~P~~~DQ~~na~~~~~~G~g~~l~~~~~~~~~l~~ai~~vl~~~  410 (500)
T PF00201_consen  335 DLLAHPRVKLFITHGGLNSTQEALYHGVPMLGIPLFGDQPRNAARVEEKGVGVVLDKNDLTEEELRAAIREVLENP  410 (500)
T ss_dssp             HHHTSTTEEEEEES--HHHHHHHHHCT--EEE-GCSTTHHHHHHHHHHTTSEEEEGGGC-SHHHHHHHHHHHHHSH
T ss_pred             hhhhcccceeeeeccccchhhhhhhccCCccCCCCcccCCccceEEEEEeeEEEEEecCCcHHHHHHHHHHHHhhh
Confidence            4789999999999999999999999999999999999999999999999999999999999999999999999876



This family currently consist of: Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose. These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A ....

>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>KOG3349|consensus Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>PRK03501 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14075 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>PRK14076 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02929 NADH kinase Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PLN02935 Bifunctional NADH kinase/NAD(+) kinase Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>PRK02231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>KOG4180|consensus Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PF11071 DUF2872: Protein of unknown function (DUF2872); InterPro: IPR019884 This entry represents a family of uncharacterised proteins, including YtoQ from Bacillus subtilis Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 2e-09
2iya_A424 The Crystal Structure Of Macrolide Glycosyltransfer 3e-07
2yjn_A441 Structure Of The Glycosyltransferase Eryciii From T 6e-05
3rsc_A415 Crystal Structure Of Calg2, Calicheamicin Glycosylt 8e-05
3iaa_A416 Crystal Structure Of Calg2, Calicheamicin Glycosylt 8e-05
2iyf_A430 The Crystal Structure Of Macrolide Glycosyltransfer 2e-04
3d0r_A398 Crystal Structure Of Calg3 From Micromonospora Echi 4e-04
2acv_A463 Crystal Structure Of Medicago Truncatula Ugt71g1 Le 7e-04
2acw_A465 Crystal Structure Of Medicago Truncatula Ugt71g1 Co 7e-04
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure

Iteration: 1

Score = 57.4 bits (137), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 26/73 (35%), Positives = 40/73 (54%) Query: 4 GHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGD 63 GH + FITHGG + EA+YHG+P V +P F+DQ N + +G + T + Sbjct: 83 GHPKTRAFITHGGANGIYEAIYHGIPXVGIPLFADQPDNIAHXKARGAAVRVDFNTXSST 142 Query: 64 ILYITIREVLNNP 76 L ++ V+N+P Sbjct: 143 DLLNALKRVINDP 155
>pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 Back     alignment and structure
>pdb|2YJN|A Chain A, Structure Of The Glycosyltransferase Eryciii From The Erythromycin Biosynthetic Pathway, In Complex With Its Activating Partner, Erycii Length = 441 Back     alignment and structure
>pdb|3RSC|A Chain A, Crystal Structure Of Calg2, Calicheamicin Glycosyltransferase, Tdp And Calicheamicin T0 Bound Form Length = 415 Back     alignment and structure
>pdb|3IAA|A Chain A, Crystal Structure Of Calg2, Calicheamicin Glycosyltransferase, Tdp Bound Form Length = 416 Back     alignment and structure
>pdb|2IYF|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 430 Back     alignment and structure
>pdb|3D0R|A Chain A, Crystal Structure Of Calg3 From Micromonospora Echinospora Determined In Space Group P2(1) Length = 398 Back     alignment and structure
>pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 Back     alignment and structure
>pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 9e-34
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 3e-24
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 9e-24
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 3e-21
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 2e-20
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 3e-18
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 1e-17
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 5e-17
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 3e-16
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 8e-16
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 6e-14
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 9e-13
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 9e-13
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 5e-12
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 2e-11
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 8e-11
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 2e-10
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 2e-10
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 3e-10
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
 Score =  112 bits (282), Expect = 9e-34
 Identities = 27/74 (36%), Positives = 43/74 (58%)

Query: 4   GHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGD 63
           GH   + FITHGG +   EA+YHG+P+V +P F+DQ  N   M+ +G  +     T++  
Sbjct: 83  GHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSST 142

Query: 64  ILYITIREVLNNPR 77
            L   ++ V+N+P 
Sbjct: 143 DLLNALKRVINDPS 156


>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} PDB: 3h4i_A* 1pn3_A* 1pnv_A* Length = 404 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.88
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 99.88
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.87
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.87
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.86
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.84
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.78
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.77
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.77
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.77
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 99.76
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.76
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.75
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.72
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.71
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.7
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.7
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.68
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.67
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.61
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 99.58
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.58
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 99.24
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.1
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 98.17
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.0
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.94
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 97.91
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.85
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 97.84
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 97.81
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 97.7
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 97.29
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 97.22
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 97.17
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 96.88
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 96.8
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 96.69
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 96.66
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 96.62
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 96.3
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.95
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 95.8
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 95.8
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 95.64
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 95.56
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 95.49
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 95.4
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 95.37
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 95.28
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 95.27
2i2c_A 272 Probable inorganic polyphosphate/ATP-NAD kinase 1; 93.62
1yt5_A 258 Inorganic polyphosphate/ATP-NAD kinase; domain 1: 93.31
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 93.0
2an1_A 292 Putative kinase; structural genomics, PSI, protein 92.03
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 91.51
1u0t_A 307 Inorganic polyphosphate/ATP-NAD kinase; alpha-beta 91.13
2pju_A225 Propionate catabolism operon regulatory protein; s 90.8
2iz6_A176 Molybdenum cofactor carrier protein; metal transpo 88.64
3afo_A 388 NADH kinase POS5; alpha/beta+BETA sandwich, ATP-bi 87.0
3pfn_A 365 NAD kinase; structural genomics consortium, SNP, S 86.1
1rcu_A195 Conserved hypothetical protein VT76; structural ge 85.55
2q5c_A196 NTRC family transcriptional regulator; structural 83.49
1eiw_A111 Hypothetical protein MTH538; CHEY-like fold, flavo 80.09
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
Probab=99.88  E-value=1.1e-22  Score=132.38  Aligned_cols=75  Identities=28%  Similarity=0.410  Sum_probs=71.0

Q ss_pred             CCCCCccceEEecCChHHHHHHHHcCCCEEEeCCCCChHHHHHHHHHh-CceeeeCCCCCCHHHHHHHHHHHHcCC
Q psy14950          2 PTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEK-GMGLITPHETITGDILYITIREVLNNP   76 (77)
Q Consensus         2 ~l~~~~~~~~i~h~G~~t~~e~l~~g~P~i~~P~~~~q~~na~~~~~~-g~g~~~~~~~~~~~~l~~~i~~~l~~~   76 (77)
                      +|.|+++++||||||+||++|++++|+|+|++|.+.||..||+++++. |+|+.+..++++.+++.++|++++.|+
T Consensus       338 vL~h~~~~~fvth~G~~S~~Eal~~GvP~i~~P~~~dQ~~Na~~l~~~~g~g~~l~~~~~~~~~l~~~i~~ll~~~  413 (456)
T 2c1x_A          338 VLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQE  413 (456)
T ss_dssp             HHTSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTSCCEEECGGGSCCHHHHHHHHHHHHHSH
T ss_pred             HhcCCcCCEEEecCCcchHHHHHHhCceEEecCChhhHHHHHHHHHHHhCeEEEecCCCcCHHHHHHHHHHHHCCC
Confidence            578999999999999999999999999999999999999999999988 999999877789999999999999774



>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A* Back     alignment and structure
>1yt5_A Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A Back     alignment and structure
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 Back     alignment and structure
>2iz6_A Molybdenum cofactor carrier protein; metal transport; 1.60A {Chlamydomonas reinhardtii} PDB: 2iz5_A 2iz7_A Back     alignment and structure
>3afo_A NADH kinase POS5; alpha/beta+BETA sandwich, ATP-binding, mitochondrion NADP, nucleotide-binding, transferase, transit peptide; HET: NAI; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfn_A NAD kinase; structural genomics consortium, SNP, SGC, transferase; 2.70A {Homo sapiens} Back     alignment and structure
>1rcu_A Conserved hypothetical protein VT76; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.50A {Thermotoga maritima} SCOP: c.129.1.1 Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 77
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 2e-16
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 7e-16
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 2e-15
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 5e-14
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 7e-13
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 2e-12
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 2e-11
d1f0ka_351 c.87.1.2 (A:) Peptidoglycan biosynthesis glycosylt 1e-04
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Gtf glycosyltransferase
domain: TDP-vancosaminyltransferase GftD
species: Amycolatopsis orientalis [TaxId: 31958]
 Score = 69.3 bits (168), Expect = 2e-16
 Identities = 18/76 (23%), Positives = 28/76 (36%)

Query: 1   MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETI 60
                R     I HG   +   A   GVP +++P  +DQ      +   G+G+     T 
Sbjct: 296 FQALFRRVAAVIHHGSAGTEHVATRAGVPQLVIPRNTDQPYFAGRVAALGIGVAHDGPTP 355

Query: 61  TGDILYITIREVLNNP 76
           T + L   +  VL   
Sbjct: 356 TFESLSAALTTVLAPE 371


>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Length = 351 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.93
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.92
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.92
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.91
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.87
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.86
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.83
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.74
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 97.29
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 96.8
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 96.42
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.07
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 95.27
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 94.28
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 93.94
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 91.33
d2pjua1186 Propionate catabolism operon regulatory protein Pr 90.76
d1u0ta_ 302 Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycob 86.57
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: (Iso)flavonoid glycosyltransferase
species: Medicago truncatula [TaxId: 3880]
Probab=99.93  E-value=3.8e-26  Score=143.41  Aligned_cols=74  Identities=28%  Similarity=0.469  Sum_probs=69.7

Q ss_pred             CCCCCccceEEecCChHHHHHHHHcCCCEEEeCCCCChHHHHHHHH-HhCceeeeCCCCCCHHHHHHHHHHHHcCC
Q psy14950          2 PTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLME-EKGMGLITPHETITGDILYITIREVLNNP   76 (77)
Q Consensus         2 ~l~~~~~~~~i~h~G~~t~~e~l~~g~P~i~~P~~~~q~~na~~~~-~~g~g~~~~~~~~~~~~l~~~i~~~l~~~   76 (77)
                      +|.||++++||||||+||++|++.+|+|||++|++.||..||.+++ ++|+|+.++. +++.++|.++|+++|+|+
T Consensus       359 lL~hp~~~~fItHGG~~s~~Eal~~GVP~lv~P~~~DQ~~na~rv~~~~G~G~~l~~-~~t~~~l~~ai~~vl~d~  433 (473)
T d2pq6a1         359 VLNHPSIGGFLTHCGWNSTTESICAGVPMLCWPFFADQPTDCRFICNEWEIGMEIDT-NVKREELAKLINEVIAGD  433 (473)
T ss_dssp             HHTSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTSCCEEECCS-SCCHHHHHHHHHHHHTSH
T ss_pred             HhcCCcCcEEEecCCccHHHHHHHcCCCEEeccchhhhHHHHHHHHHHcCeEEeeCC-CcCHHHHHHHHHHHHcCC
Confidence            6899999999999999999999999999999999999999999995 5699999985 789999999999999885



>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure