Diaphorina citri psyllid: psy14956

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MFCVDILDALTKDFFARKGNPIEETGDLVAEVNTRPDEAGYDPVSSTLWRQREEYCARLIQHAWRKHKQCRAGGTEPGSPGSPDGRDTAVLVESDGFSIKNGHRVVIHSRSPSQTSRSAECLFSFKDFSMGKWAYLCLLCGKNRETS
ccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccccccEEEEcccccccccccccEEEEEccccccHHHHHHHHHccccccc
MFCVDILDALTKDFFARKGNPIEETGDLVAEV******AGYDPVSSTLWRQREEYCARLIQHAWRK******************************FSIKNGHRVVI************ECLFSFKDFSMGKWAYLCLLCGKN****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFCVDILDALTKDFFARKGNPIEETGDLVAEVNTRPDEAGYDPVSSTLWRQREEYCARLIQHAWRKHKQCRAGGTEPGSPGSPDGRDTAVLVESDGFSIKNGHRVVIHSRSPSQTSRSAECLFSFKDFSMGKWAYLCLLCGKNRETS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium channel protein para Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.confidentP35500

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DCK, chain A
Confidence level:very confident
Coverage over the Query: 1-73
View the alignment between query and template
View the model in PyMOL