Diaphorina citri psyllid: psy14962


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MQQARIIELLEPKIQEGAKVLDIGSGSGFMSCVFAELVGKTGRVFGVEHMREQCEDAWETVMRIRPDLLNDGRLHLRCRDGRTGLLHQAPFDAIYLSTYVPEIPYSILLQLKPGGRLVCGVGKSKSYHRMTVIDRSEDGTHFQKYEISLENFINPLINADEQNDNWLYQQSRSEDGTHFQKYEISLENFINPLINADEQNDNWLYQQSRNHVLKEW
ccHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccEEEEEcccccccHHHHHccccccEEEEEECcccccEEEEEEEEcccccEEEEEEEEEEEEEccccccccccccccccccccccccccccccccHHHcccccccccccccccHHHHHcccccccc
MQQARIIELLEPKIQEGAKVLDIGSGSGFMSCVFAELVGKTGRVFGVEHMREQCEDAWETVMRIRPDLLNDGRLHLRCRDGRTGLLHQAPFDAIYLSTYVPEIPYSILLQLKPGGRLVCGVGKSKSYHRMTVIDRSEDGTHFQKYEISLENFINPLINADEQNDNWLYQQ****DGTHFQKYEISLENFINPLINADEQNDNWLYQQSRN******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQARIIELLEPKIQEGAKVLDIGSGSGFMSCVFAELVGKTGRVFGVEHMREQCEDAWETVMRIRPDLLNDGRLHLRCRDGRTGLLHQAPFDAIYLSTYVPEIPYSILLQLKPGGRLVCGVGKSKSYHRMTVIDRSEDGTHFQKYEISLENFINPLINADEQNDNWLYQQSRSEDGTHFQKYEISLENFINPLINADEQNDNWLYQQSRNHVLKEW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein-L-isoaspartate O-methyltransferase Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.confidentQ02R96
Protein-L-isoaspartate O-methyltransferase Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.confidentQ9YDA1
Protein-L-isoaspartate(D-aspartate) O-methyltransferase Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. Acts on microtubule-associated protein 2, calreticulin, clathrin light chains a and b, Ubiquitin carboxyl-terminal hydrolase isozyme L1, phosphatidylethanolamine-binding protein 1, stathmin, beta-synuclein and alpha-synuclein.confidentP22062

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006479 [BP]protein methylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0008213, GO:0071704, GO:0043412, GO:0036211, GO:0043414, GO:0044237, GO:0008152, GO:0008150, GO:0032259
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0018197 [BP]peptidyl-aspartic acid modificationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0046500 [BP]S-adenosylmethionine metabolic processprobableGO:0006520, GO:0006732, GO:0019752, GO:0034641, GO:0006807, GO:0044281, GO:0072521, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0042278, GO:0071704, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0043436, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:1901135, GO:0044237, GO:1901657, GO:0006790
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0033555 [BP]multicellular organismal response to stressprobableGO:0032501, GO:0044707, GO:0050896, GO:0006950, GO:0008150, GO:0044699
GO:0046498 [BP]S-adenosylhomocysteine metabolic processprobableGO:0042278, GO:0019752, GO:0034641, GO:0006807, GO:0044281, GO:0072521, GO:1901360, GO:0006139, GO:0044710, GO:0006520, GO:0071704, GO:1901605, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0043436, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:1901135, GO:0044237, GO:1901657, GO:0006790
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0008757 [MF]S-adenosylmethionine-dependent methyltransferase activityprobableGO:0008168, GO:0016740, GO:0016741, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I1N, chain A
Confidence level:very confident
Coverage over the Query: 3-160
View the alignment between query and template
View the model in PyMOL
Template: 3BKW, chain A
Confidence level:confident
Coverage over the Query: 14-204
View the alignment between query and template
View the model in PyMOL