Diaphorina citri psyllid: psy14973


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MVKRNQLISFQRFDREGTRGPAKKPQPAASKKGGASKDGESSGGPAGSWCLEGMRFVKVDEFRGRPLISIREYYEKNGQLLPGKKGISLSATQWRKLLTLQDSVNSELDKY
cccccccccHHHcccccccccccccccccccccccccccccccccccEEEEcccEEEEEEECcccEEEEEEEEEEcccccccccccECccHHHHHHHHHHHHHHHHHHHHc
***********************************************SWCLEGMRFVKVDEFRGRPLISIREYYEKNGQLLPGKKGISLSATQWRKLLTLQDSVNSELDKY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKRNQLISFQRFDREGTRGPAKKPQPAASKKGGASKDGESSGGPAGSWCLEGMRFVKVDEFRGRPLISIREYYEKNGQLLPGKKGISLSATQWRKLLTLQDSVNSELDKY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA polymerase II transcriptional coactivator General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. Binds single-stranded DNA (By similarity). Binds specifically to the NssBF element, a short nucleotide sequence of the 1731 retrotransposon, to repress promoter activity.confidentQ9VLR5
Activated RNA polymerase II transcriptional coactivator p15 General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).confidentQ5ZK63
Activated RNA polymerase II transcriptional coactivator p15 General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).confidentQ63396

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PCF, chain A
Confidence level:very confident
Coverage over the Query: 47-111
View the alignment between query and template
View the model in PyMOL
Template: 4AGH, chain A
Confidence level:very confident
Coverage over the Query: 34-111
View the alignment between query and template
View the model in PyMOL