Diaphorina citri psyllid: psy14982


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
IDLEDPETEKAATKIQAVFRDIDLEDPETEKAATKIQAVFRGHKTRKDIEETMKTGDDETQNFEQEFSADDK
cccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccc
***********************LEDPETEKAATKIQAVFR*******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IDLEDPETEKAATKIQAVFRDIDLEDPETEKAATKIQAVFRGHKTRKDIEETMKTGDDETQNFEQEFSADDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IX7, chain C
Confidence level:very confident
Coverage over the Query: 7-52
View the alignment between query and template
View the model in PyMOL