Diaphorina citri psyllid: psy15002

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MDVFRPTTYSRRVQTFLAPKFGSSLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEAKV
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEECcccccEEEEccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHccHHHcccEEEcccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccEEEccccccccccccHccccccccEEEcccccccccccccccccccccEEccccccccccccHcccccccccEEEccccccccccHHHcccccccc
********YSRRVQTFLAPKFGSSLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEAKV
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVFRPTTYSRRVQTFLAPKFGSSLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEAKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0002682 [BP]regulation of immune system processprobableGO:0008150, GO:0065007, GO:0050789
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:1901681 [MF]sulfur compound bindingprobableGO:0003674, GO:0005488
GO:0051960 [BP]regulation of nervous system developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0030336 [BP]negative regulation of cell migrationprobableGO:0040013, GO:0051270, GO:0065007, GO:0051271, GO:0040012, GO:0008150, GO:0030334, GO:2000145, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0050922 [BP]negative regulation of chemotaxisprobableGO:0040013, GO:0040012, GO:0032102, GO:0032101, GO:0048585, GO:0048583, GO:0050795, GO:0008150, GO:0065007, GO:0050920, GO:0048519, GO:0048521, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 58-356
View the alignment between query and template
View the model in PyMOL