Psyllid ID: psy15002


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MDVFRPTTYSRRVQTFLAPKFGSSLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEAKV
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEcccccEEEEccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHccHHHcccEEEccccccccccHHHHHccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEcccccccccccHHHccccccccEEEccccccccccHHHcccccccc
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHccccccHHHHHHHHcccccccccccHHHccccHcccEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHHHHHcEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHHHHHHHcccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHccccccc
mdvfrpttysRRVQTflapkfgssLATSFLCLLLLLPccllqsvqqcpphneispcqcsvkkngldILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLrhnnlpkltgfiffgldirhltihnsslaVVEESSLSSIGKKLKrlnlggneltrvpqtslskLENLRKLELLHNRIALIeegdfegkaltqldlsqnslavvpspalksLNHLLILNLNHNKIsalhsnafqgldTLEILTIFENklsliepdsfKGLEKKLKRLnlggneltrvpqtslskLENLRKLELLHNRIALIeegdfeglhnLDSLVLAHnqlrtipprvfahlpllnsleldgnhihtvdpaafsgleakv
mdvfrpttysrrvqtflaPKFGSSLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLAVVEESSLSSIGKKLkrlnlggneltrvpqtslsklenlRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKrlnlggneltrvpqtslsklenlRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVdpaafsgleakv
MDVFRPTTYSRRVQTFLAPKFGSSLATSFlclllllpccllQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNsslavveesslssIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPAlkslnhllilnlnhnkisALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEAKV
********YSRRVQTFLAPKFGSSLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLAVVE************RLNLG************SKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRV**TSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDP**********
***********************SLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEAKV
********YSRRVQTFLAPKFGSSLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLA**********GKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEAKV
***FRPTTYSRRVQTFLAPKFGSSLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEAK*
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVFRPTTYSRRVQTFLAPKFGSSLATSFLCLLLLLPCCLLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGLDIRHLTIHNSSLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEAKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query357 2.2.26 [Sep-21-2011]
Q9GZU5 481 Nyctalopin OS=Homo sapien yes N/A 0.717 0.532 0.330 2e-23
Q6NUI6 762 Chondroadherin-like prote no N/A 0.635 0.297 0.319 1e-22
O94898 1065 Leucine-rich repeats and no N/A 0.725 0.243 0.290 2e-21
O02833 605 Insulin-like growth facto N/A N/A 0.731 0.431 0.310 2e-21
P35858 605 Insulin-like growth facto no N/A 0.661 0.390 0.315 3e-21
Q80X72 579 Leucine-rich repeat-conta no N/A 0.719 0.443 0.295 8e-21
P70193 1091 Leucine-rich repeats and no N/A 0.747 0.244 0.350 1e-20
P83503 476 Nyctalopin OS=Mus musculu no N/A 0.770 0.577 0.300 9e-20
Q496Z2 811 TLR4 interactor with leuc no N/A 0.669 0.294 0.329 2e-19
Q9DBB9 547 Carboxypeptidase N subuni no N/A 0.756 0.493 0.303 3e-19
>sp|Q9GZU5|NYX_HUMAN Nyctalopin OS=Homo sapiens GN=NYX PE=1 SV=1 Back     alignment and function desciption
 Score =  110 bits (274), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 140/278 (50%), Gaps = 22/278 (7%)

Query: 55  PCQC---SVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFF 111
           PC+     + +NGL  L E     +   T+ +L+         L LRHNNL  +T   F 
Sbjct: 61  PCEAVSIDLDRNGLRFLGE-----RAFGTLPSLR--------RLSLRHNNLSFITPGAFK 107

Query: 112 GL-DIRHLTI-HNSSLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLEL 169
           GL  +  L + HN  L  +   + +++  +L+RL+L    L  VP+  L++L  LR+L  
Sbjct: 108 GLPRLAELRLAHNGDLRYLHARTFAAL-SRLRRLDLAACRLFSVPERLLAELPALRELAA 166

Query: 170 LHNRIALIEEGDFEGKA-LTQLDLSQNSLAVVPSPALKSLNHLLILNLNHNKISALHSNA 228
             N    +  G   G A LT   L +  +  V S +L+ L  L  L+L  N++ A+H+ A
Sbjct: 167 FDNLFRRVP-GALRGLANLTHAHLERGRIEAVASSSLQGLRRLRSLSLQANRVRAVHAGA 225

Query: 229 FQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLE 288
           F     LE L + +N L+ +  D+F+GL ++L+ LNLGGN L RV +   + L  L  L 
Sbjct: 226 FGDCGVLEHLLLNDNLLAELPADAFRGL-RRLRTLNLGGNALDRVARAWFADLAELELLY 284

Query: 289 LLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVF 326
           L  N IA +EEG F+ L  L +L L  N+L  +    F
Sbjct: 285 LDRNSIAFVEEGAFQNLSGLLALHLNGNRLTVLAWVAF 322





Homo sapiens (taxid: 9606)
>sp|Q6NUI6|CHADL_HUMAN Chondroadherin-like protein OS=Homo sapiens GN=CHADL PE=2 SV=2 Back     alignment and function description
>sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 Back     alignment and function description
>sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 Back     alignment and function description
>sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 Back     alignment and function description
>sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description
>sp|P70193|LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus GN=Lrig1 PE=2 SV=2 Back     alignment and function description
>sp|P83503|NYX_MOUSE Nyctalopin OS=Mus musculus GN=Nyx PE=2 SV=1 Back     alignment and function description
>sp|Q496Z2|TRIL_RAT TLR4 interactor with leucine rich repeats OS=Rattus norvegicus GN=Tril PE=2 SV=1 Back     alignment and function description
>sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
270013642 479 hypothetical protein TcasGA2_TC012268 [T 0.747 0.557 0.590 8e-95
91089843 468 PREDICTED: similar to slit protein [Trib 0.733 0.559 0.596 9e-95
158295509 503 AGAP006183-PA [Anopheles gambiae str. PE 0.739 0.524 0.608 4e-94
312373555 607 hypothetical protein AND_17272 [Anophele 0.739 0.434 0.608 1e-93
193643421 490 PREDICTED: slit homolog 3 protein-like i 0.739 0.538 0.583 3e-93
195430118 486 GK21558 [Drosophila willistoni] gi|19415 0.778 0.572 0.552 2e-86
195029059 505 GH19994 [Drosophila grimshawi] gi|193903 0.733 0.518 0.558 3e-86
19921788 470 CG14762, isoform A [Drosophila melanogas 0.736 0.559 0.543 8e-83
194863620 470 GG10684 [Drosophila erecta] gi|190662397 0.736 0.559 0.543 8e-83
308193433440 RT10125p [Drosophila melanogaster] 0.736 0.597 0.543 1e-82
>gi|270013642|gb|EFA10090.1| hypothetical protein TcasGA2_TC012268 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  353 bits (905), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 217/315 (68%), Gaps = 48/315 (15%)

Query: 40  LLQSVQQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRH 99
           L +  QQCP  +EISPC C++KKNGLDILCEFTD Q I   M  LK +   +IFYLKLRH
Sbjct: 16  LFEVQQQCPARSEISPCSCTLKKNGLDILCEFTDQQHITSAMDKLKGRE-FVIFYLKLRH 74

Query: 100 NNLPKLTGFIFFGLDIRHLTIHNSSLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLS 159
           NNL KLTG+IF GLDI HLTIHNSSL+ +EE SLSSIG                      
Sbjct: 75  NNLRKLTGYIFLGLDIHHLTIHNSSLSTMEEMSLSSIG---------------------- 112

Query: 160 KLENLRKLELLHNRIALIEEGDFEGKALTQLDLSQNSLAVVPSPALKSLNHLLILNLNHN 219
                                    K LTQLD+SQNSL  VPS A  SL+ LLILN+NHN
Sbjct: 113 -------------------------KMLTQLDVSQNSLTAVPSSAFASLHQLLILNMNHN 147

Query: 220 KISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLS 279
           KIS +HS AFQGLDTLEILT++ENK++ IE  +F GLEKKLKRLNLGGN LT VPQ +LS
Sbjct: 148 KISVVHSKAFQGLDTLEILTLYENKITTIEDGAFVGLEKKLKRLNLGGNSLTEVPQKALS 207

Query: 280 KLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDG 339
            L+ L+KLE+  NR+  I+EGDFEGL NLDSL LAHN+LR +P RVF+HL +LNSLELDG
Sbjct: 208 ILDTLKKLEMQENRLTEIKEGDFEGLKNLDSLGLAHNKLRQVPSRVFSHLTVLNSLELDG 267

Query: 340 NHIHTVDPAAFSGLE 354
           N+I T+DP AF+GLE
Sbjct: 268 NNIDTIDPEAFAGLE 282




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91089843|ref|XP_970465.1| PREDICTED: similar to slit protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158295509|ref|XP_316248.3| AGAP006183-PA [Anopheles gambiae str. PEST] gi|157016072|gb|EAA11472.3| AGAP006183-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312373555|gb|EFR21270.1| hypothetical protein AND_17272 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|193643421|ref|XP_001943456.1| PREDICTED: slit homolog 3 protein-like isoform 1 [Acyrthosiphon pisum] gi|328701463|ref|XP_003241608.1| PREDICTED: slit homolog 3 protein-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195430118|ref|XP_002063104.1| GK21558 [Drosophila willistoni] gi|194159189|gb|EDW74090.1| GK21558 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195029059|ref|XP_001987392.1| GH19994 [Drosophila grimshawi] gi|193903392|gb|EDW02259.1| GH19994 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|19921788|ref|NP_610346.1| CG14762, isoform A [Drosophila melanogaster] gi|16767862|gb|AAL28149.1| GH01839p [Drosophila melanogaster] gi|21627755|gb|AAF59148.2| CG14762, isoform A [Drosophila melanogaster] gi|220944972|gb|ACL85029.1| CG14762-PA [synthetic construct] gi|220954740|gb|ACL89913.1| CG14762-PA [synthetic construct] Back     alignment and taxonomy information
>gi|194863620|ref|XP_001970530.1| GG10684 [Drosophila erecta] gi|190662397|gb|EDV59589.1| GG10684 [Drosophila erecta] Back     alignment and taxonomy information
>gi|308193433|gb|ADO16258.1| RT10125p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
FB|FBgn0033250 470 CG14762 [Drosophila melanogast 0.857 0.651 0.414 3.6e-50
MGI|MGI:107935 1091 Lrig1 "leucine-rich repeats an 0.843 0.275 0.312 9.8e-24
UNIPROTKB|Q96JA1 1093 LRIG1 "Leucine-rich repeats an 0.787 0.257 0.307 1.7e-21
UNIPROTKB|G3N218 478 G3N218 "Uncharacterized protei 0.627 0.468 0.334 5.9e-21
UNIPROTKB|Q8TF66 581 LRRC15 "Leucine-rich repeat-co 0.719 0.442 0.272 2.2e-20
MGI|MGI:1921738 579 Lrrc15 "leucine rich repeat co 0.719 0.443 0.268 2.8e-20
UNIPROTKB|F1NJ43 466 NYX "Uncharacterized protein" 0.756 0.579 0.315 4.2e-20
MGI|MGI:1315205 1521 Slit2 "slit homolog 2 (Drosoph 0.442 0.103 0.306 2e-14
UNIPROTKB|I3LFJ7 477 NYX "Uncharacterized protein" 0.619 0.463 0.330 4.5e-20
UNIPROTKB|Q9GZU5 481 NYX "Nyctalopin" [Homo sapiens 0.627 0.465 0.326 5.9e-20
FB|FBgn0033250 CG14762 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 522 (188.8 bits), Expect = 3.6e-50, P = 3.6e-50
 Identities = 129/311 (41%), Positives = 166/311 (53%)

Query:    45 QQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPK 104
             Q CP  +EI+PC C+VKKNGLDILCE TD   I  +M TLK KS  IIFYLKLRHNNLPK
Sbjct:    37 QVCPEQSEIAPCICTVKKNGLDILCETTDLAHITKSMGTLKGKSP-IIFYLKLRHNNLPK 95

Query:   105 LTGFIFFGLDIRHLTIHNXXXXXXXXXXXXXIGKKLKRLNLGGNELTRVPQTSLSKLENL 164
             L GF+F  LDIRHLTIHN             +G  L +L++  N++  VP  +L  L +L
Sbjct:    96 LQGFVFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQHLFHL 155

Query:   165 RKLELLHNRIALIEEGDFEG-KALTQLDLSQNSLAVV-PSPAXXXXXXXXXXXXXXXXXX 222
               L L HN+I +I    FEG + L  L L +N +  + P                     
Sbjct:   156 LILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLT 215

Query:   223 ALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLE 282
              +   A   L TL+ L I ENK+  I    F+GL+  L  L L  N +T VP    S L 
Sbjct:   216 NIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQS-LDSLILAHNMITTVPANVFSHLT 274

Query:   283 NLRKLELLHNRIALIEEGDFEGLH-NLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNH 341
              L  LEL  N+I++I++  F+GL  NL  L L  NQ+ TIP      L  L  L+L  N+
Sbjct:   275 LLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNN 334

Query:   342 IHTVDPAAFSG 352
             I+ +   AF+G
Sbjct:   335 INVLAEDAFTG 345


GO:0048812 "neuron projection morphogenesis" evidence=IMP
MGI|MGI:107935 Lrig1 "leucine-rich repeats and immunoglobulin-like domains 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q96JA1 LRIG1 "Leucine-rich repeats and immunoglobulin-like domains protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3N218 G3N218 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TF66 LRRC15 "Leucine-rich repeat-containing protein 15" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1921738 Lrrc15 "leucine rich repeat containing 15" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ43 NYX "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1315205 Slit2 "slit homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LFJ7 NYX "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GZU5 NYX "Nyctalopin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 56.4 bits (137), Expect = 1e-10
 Identities = 28/60 (46%), Positives = 41/60 (68%)

Query: 283 NLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHI 342
           NL+ L+L +NR+ +I +G F+GL NL  L L+ N L +I P  F+ LP L SL+L GN++
Sbjct: 1   NLKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGNNLTSISPEAFSGLPSLRSLDLSGNNL 60


Length = 60

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 357
KOG4194|consensus 873 100.0
KOG4194|consensus 873 100.0
KOG4237|consensus 498 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG4237|consensus 498 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.9
KOG0444|consensus 1255 99.89
KOG0444|consensus 1255 99.89
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.87
KOG0472|consensus 565 99.86
KOG0472|consensus 565 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG0618|consensus 1081 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
KOG0618|consensus 1081 99.79
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
KOG0617|consensus264 99.67
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.66
KOG0617|consensus264 99.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
KOG1259|consensus490 99.44
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.39
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.35
KOG3207|consensus 505 99.33
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.33
KOG0532|consensus 722 99.32
KOG3207|consensus 505 99.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.31
KOG0532|consensus 722 99.29
KOG1259|consensus490 99.28
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.17
KOG0531|consensus 414 99.14
KOG0531|consensus414 99.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.11
KOG1909|consensus382 99.11
KOG1909|consensus382 99.01
KOG4658|consensus889 98.85
PLN03150623 hypothetical protein; Provisional 98.75
PLN03150 623 hypothetical protein; Provisional 98.72
KOG1859|consensus 1096 98.69
KOG1859|consensus 1096 98.68
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.62
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.61
KOG1644|consensus233 98.61
KOG4579|consensus177 98.46
KOG4579|consensus177 98.42
KOG4658|consensus 889 98.4
KOG2982|consensus 418 98.38
KOG1644|consensus233 98.32
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.3
KOG2982|consensus 418 98.27
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.26
PRK15386 426 type III secretion protein GogB; Provisional 98.22
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.21
KOG2120|consensus419 98.18
KOG2120|consensus419 98.05
PRK15386 426 type III secretion protein GogB; Provisional 98.0
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.94
KOG3665|consensus 699 97.65
KOG3665|consensus 699 97.47
KOG2739|consensus260 97.43
KOG2123|consensus 388 96.97
KOG2123|consensus 388 96.88
KOG2739|consensus260 96.7
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.39
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.02
KOG4341|consensus483 95.54
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.46
smart0037026 LRR Leucine-rich repeats, outliers. 95.41
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.4
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.38
smart0037026 LRR Leucine-rich repeats, outliers. 95.38
KOG4341|consensus483 95.36
PF0146228 LRRNT: Leucine rich repeat N-terminal domain; Inte 94.28
KOG1947|consensus482 93.78
KOG1947|consensus482 93.23
KOG3864|consensus221 93.07
KOG4308|consensus 478 91.99
smart0001333 LRRNT Leucine rich repeat N-terminal domain. 91.82
KOG0473|consensus326 90.3
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.13
KOG3864|consensus221 88.78
KOG0473|consensus 326 88.29
KOG4308|consensus478 87.1
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.43
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 85.28
>KOG4194|consensus Back     alignment and domain information
Probab=100.00  E-value=9.5e-37  Score=273.28  Aligned_cols=296  Identities=27%  Similarity=0.468  Sum_probs=246.9

Q ss_pred             cCCCCCCCCCCceeccccCCeEEecccCChhhHHHHHhhhccCCCceEEEEEecCCCCcCccccccCCC-cccEEEecCC
Q psy15002         45 QQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGL-DIRHLTIHNS  123 (357)
Q Consensus        45 ~~Cp~~~~~~~C~C~~~~~~~~~~C~~~~l~~i~~~~~~~~~~~~~~l~~L~l~~~~i~~l~~~~~~~~-~L~~L~l~~~  123 (357)
                      ..||.     +|.|...    -.+|...++..+..  ..+.+..|..++.|++++|.+.++....|... +|+.+.+.+|
T Consensus        44 ~~cpa-----~c~c~~~----lldcs~~~lea~~~--~~l~g~lp~~t~~LdlsnNkl~~id~~~f~nl~nLq~v~l~~N  112 (873)
T KOG4194|consen   44 SECPA-----TCPCNTR----LLDCSDRELEAIDK--SRLKGFLPSQTQTLDLSNNKLSHIDFEFFYNLPNLQEVNLNKN  112 (873)
T ss_pred             ccCCC-----cCCCCce----eeecCccccccccc--cccCCcCccceeeeeccccccccCcHHHHhcCCcceeeeeccc
Confidence            48998     7999865    89999999887653  46778888999999999999999999888777 9999999999


Q ss_pred             CcceecCcccccccccceEEEccCCcCceeChhhhcCCCCCcEEeccCCccccccCCCCCC-CCCCeEECCCCCCeeeCc
Q psy15002        124 SLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEG-KALTQLDLSQNSLAVVPS  202 (357)
Q Consensus       124 ~l~~~~~~~~~~l~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~-~~L~~L~l~~n~l~~~~~  202 (357)
                      .++.|+..  .+...+|+.|++.+|.|+.+..+.+..++.|+.|||+.|.|++++...|.. .++++|++++|.|+.+..
T Consensus       113 ~Lt~IP~f--~~~sghl~~L~L~~N~I~sv~se~L~~l~alrslDLSrN~is~i~~~sfp~~~ni~~L~La~N~It~l~~  190 (873)
T KOG4194|consen  113 ELTRIPRF--GHESGHLEKLDLRHNLISSVTSEELSALPALRSLDLSRNLISEIPKPSFPAKVNIKKLNLASNRITTLET  190 (873)
T ss_pred             hhhhcccc--cccccceeEEeeeccccccccHHHHHhHhhhhhhhhhhchhhcccCCCCCCCCCceEEeecccccccccc
Confidence            99988743  333356999999999999999999999999999999999999999888887 899999999999999999


Q ss_pred             cccCCCCcCceeecccccCcccCcccCCCCCCCCEEEccCCcCcccCCCccccccccccEEEccCCcCcccCcccccCCC
Q psy15002        203 PALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLE  282 (357)
Q Consensus       203 ~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~  282 (357)
                      +.|.++.+|.+|.|+.|+++.++...|+.+++|+.|+|..|+|..+....|.++ ++++.|.+..|++..+..+.|..+.
T Consensus       191 ~~F~~lnsL~tlkLsrNrittLp~r~Fk~L~~L~~LdLnrN~irive~ltFqgL-~Sl~nlklqrN~I~kL~DG~Fy~l~  269 (873)
T KOG4194|consen  191 GHFDSLNSLLTLKLSRNRITTLPQRSFKRLPKLESLDLNRNRIRIVEGLTFQGL-PSLQNLKLQRNDISKLDDGAFYGLE  269 (873)
T ss_pred             ccccccchheeeecccCcccccCHHHhhhcchhhhhhccccceeeehhhhhcCc-hhhhhhhhhhcCcccccCcceeeec
Confidence            999999999999999999999999999989999999999998887766677777 6777777777777777777777777


Q ss_pred             CCcEEEccCCcCceeCcCcCCCCCCCCEeecCCCcCcccCcccCCCCCCCcEEeCCCCcccccCcccccCcc
Q psy15002        283 NLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLE  354 (357)
Q Consensus       283 ~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~L~~N~l~~~~~~~~~~l~  354 (357)
                      ++++|+|+.|+++.+..+++-++++|+.|+|++|.|..+....+..+++|+.|+|++|.++..++++|..+.
T Consensus       270 kme~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~rih~d~WsftqkL~~LdLs~N~i~~l~~~sf~~L~  341 (873)
T KOG4194|consen  270 KMEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQRIHIDSWSFTQKLKELDLSSNRITRLDEGSFRVLS  341 (873)
T ss_pred             ccceeecccchhhhhhcccccccchhhhhccchhhhheeecchhhhcccceeEeccccccccCChhHHHHHH
Confidence            777777777777777776666777777777777777777766666677777777777777777777766554



>KOG4194|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PF01462 LRRNT: Leucine rich repeat N-terminal domain; InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00013 LRRNT Leucine rich repeat N-terminal domain Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-15
1p8t_A 285 Crystal Structure Of Nogo-66 Receptor Length = 285 5e-08
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-15
1ozn_A 285 1.5a Crystal Structure Of The Nogo Receptor Ligand 6e-08
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 3e-14
3kj4_A 286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 9e-08
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-13
3zyn_A 321 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-04
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-13
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 3e-04
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 1e-13
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-12
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-11
2o6q_A 270 Structural Diversity Of The Hagfish Variable Lympho 2e-08
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 3e-12
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 1e-11
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 3e-08
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 3e-10
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 3e-10
2ft3_A 332 Crystal Structure Of The Biglycan Dimer Core Protei 2e-05
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 4e-10
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-10
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 8e-09
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-10
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 8e-09
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 9e-10
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 2e-09
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 4e-09
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 5e-09
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-06
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 6e-09
1xcd_A 329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 6e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 6e-09
1xku_A 330 Crystal Structure Of The Dimeric Protein Core Of De 6e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 7e-09
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 7e-08
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 7e-08
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 7e-08
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 8e-08
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 8e-08
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 9e-08
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 1e-07
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 1e-07
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 1e-07
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 1e-07
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 1e-07
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 2e-07
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 3e-07
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 1e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-07
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 4e-07
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 2e-05
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 1e-06
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 1e-06
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 2e-06
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 2e-04
2xot_A 361 Crystal Structure Of Neuronal Leucine Rich Repeat P 3e-06
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 3e-06
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 6e-04
2z80_A 353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 3e-06
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 4e-06
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 5e-04
2z7x_A 549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 5e-06
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 1e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-05
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 4e-05
3b2d_A 603 Crystal Structure Of Human Rp105MD-1 Complex Length 2e-04
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 3e-04
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 3e-04
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 3e-04
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 3e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 6e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 9e-04
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure

Iteration: 1

Score = 80.1 bits (196), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 70/216 (32%), Positives = 95/216 (43%), Gaps = 25/216 (11%) Query: 141 KRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGKAL-TQLDLSQNSLAV 199 +R+ L GN ++ VP S NL L L N +A I+ F G AL QLDLS N+ Sbjct: 34 QRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLR 93 Query: 200 VPSPAXXXXXXXXXXXXXXXXXXALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKK 259 PA F GL L L + L + P F+GL Sbjct: 94 SVDPA-----------------------TFHGLGRLHTLHLDRCGLQELGPGLFRGL-AA 129 Query: 260 LKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLR 319 L+ L L N L +P + L NL L L NRI+ + E F GLH+LD L+L N++ Sbjct: 130 LQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVA 189 Query: 320 TIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEA 355 + P F L L +L L N++ + A + L A Sbjct: 190 HVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRA 225
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-58
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-57
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-53
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-49
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-44
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-55
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-53
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-49
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-55
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-54
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-49
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-53
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-50
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-50
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-48
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-45
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-45
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-28
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-47
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-44
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-43
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-17
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 6e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-47
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-45
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-44
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-45
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-42
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-41
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-35
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-30
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-43
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-43
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-42
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-42
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-39
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-37
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-30
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-41
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-40
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-38
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-33
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-39
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-35
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-32
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-26
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-38
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-38
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-37
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-38
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-35
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-33
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-30
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-29
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-37
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-37
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-37
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-30
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-28
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-37
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-32
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-32
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-36
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-35
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-34
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-36
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-31
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-35
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-35
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-32
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-32
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-18
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-34
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-33
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-34
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-33
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-30
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-29
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-23
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-18
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 1e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-28
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-25
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-22
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-28
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-19
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-23
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-18
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-21
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-25
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-24
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-23
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-23
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-20
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-19
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-21
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 8e-15
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 7e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-21
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-19
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-19
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-19
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-17
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 5e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-18
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-13
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-06
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-06
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 1e-04
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
 Score =  194 bits (495), Expect = 4e-58
 Identities = 73/263 (27%), Positives = 123/263 (46%), Gaps = 6/263 (2%)

Query: 94  YLKLRHNNLPKLTGFIFFGLD-IRHLTIHNSSLAVVEESSLSSIGKKLKRLNLGGNELTR 152
            L+L  N +  +    F  L  +R L + ++ L ++     + +   L +L++  N++  
Sbjct: 60  ELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGL-SNLTKLDISENKIVI 118

Query: 153 VPQTSLSKLENLRKLELLHNRIALIEEGDFEG-KALTQLDLSQNSLAVVPSPALKSLNHL 211
           +       L NL+ LE+  N +  I    F G  +L QL L + +L  +P+ AL  L+ L
Sbjct: 119 LLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL 178

Query: 212 LILNLNHNKISALHSNAFQGLDTLEILTI-FENKLSLIEPDSFKGLEKKLKRLNLGGNEL 270
           ++L L H  I+A+   +F+ L  L++L I     L  + P+   GL   L  L++    L
Sbjct: 179 IVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGL--NLTSLSITHCNL 236

Query: 271 TRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLP 330
           T VP  ++  L  LR L L +N I+ IE      L  L  + L   QL  + P  F  L 
Sbjct: 237 TAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLN 296

Query: 331 LLNSLELDGNHIHTVDPAAFSGL 353
            L  L + GN + T++ + F  +
Sbjct: 297 YLRVLNVSGNQLTTLEESVFHSV 319


>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 100.0
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 100.0
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.98
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.94
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.93
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.92
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.9
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.9
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.9
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.89
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.89
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.88
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.87
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.85
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.85
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.83
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.83
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.83
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.65
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.6
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.6
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.56
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.54
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.4
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.38
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.33
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.32
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.0
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.75
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.1
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.08
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 90.31
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 88.41
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.2e-38  Score=297.91  Aligned_cols=296  Identities=26%  Similarity=0.416  Sum_probs=257.7

Q ss_pred             CCCCCCCCCCceeccccCCeEEecccCChhhHHHHHhhhccCCCceEEEEEecCCCCcCccccccCCC-cccEEEecCCC
Q psy15002         46 QCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGL-DIRHLTIHNSS  124 (357)
Q Consensus        46 ~Cp~~~~~~~C~C~~~~~~~~~~C~~~~l~~i~~~~~~~~~~~~~~l~~L~l~~~~i~~l~~~~~~~~-~L~~L~l~~~~  124 (357)
                      .||.     .|.|....  ..+.|...+++.+|..+       +..++.|++++|.++.+++..|... +|++|++++|.
T Consensus         2 ~Cp~-----~C~C~~~~--~~v~c~~~~l~~ip~~~-------~~~l~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~   67 (477)
T 2id5_A            2 GCPP-----RCECSAQD--RAVLCHRKRFVAVPEGI-------PTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENI   67 (477)
T ss_dssp             CCST-----TCEEETTT--TEEECCSCCCSSCCSCC-------CTTCSEEECCSSCCCEECTTTTTTCTTCCEEECTTSC
T ss_pred             cccC-----CCeECCCC--CEEEeCCCCcCcCCCCC-------CCCCcEEECCCCccceECHhHccCCCCCCEEECCCCc
Confidence            6999     69997643  38999999998887532       5788999999999999998888777 89999999999


Q ss_pred             cceecCcccccccccceEEEccCCcCceeChhhhcCCCCCcEEeccCCccccccCCCCC-CCCCCeEECCCCCCeeeCcc
Q psy15002        125 LAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFE-GKALTQLDLSQNSLAVVPSP  203 (357)
Q Consensus       125 l~~~~~~~~~~l~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~-~~~L~~L~l~~n~l~~~~~~  203 (357)
                      ++.+.+.+|..+ ++|++|++++|.++.++...|.++++|++|++++|.++.+++..+. +++|++|++++|.+..+.+.
T Consensus        68 i~~~~~~~~~~l-~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~  146 (477)
T 2id5_A           68 VSAVEPGAFNNL-FNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHR  146 (477)
T ss_dssp             CCEECTTTTTTC-TTCCEEECCSSCCCSCCTTSSTTCTTCCEEECTTSCCCEECTTTTTTCTTCCEEEECCTTCCEECTT
T ss_pred             cCEeChhhhhCC-ccCCEEECCCCcCCccCcccccCCCCCCEEECCCCccccCChhHccccccCCEEECCCCccceeChh
Confidence            999999999988 6799999999999999998899999999999999999988766554 49999999999999999988


Q ss_pred             ccCCCCcCceeecccccCcccCcccCCCCCCCCEEEccCCcCcccCCCcccccc-----------------------ccc
Q psy15002        204 ALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLE-----------------------KKL  260 (357)
Q Consensus       204 ~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~-----------------------~~L  260 (357)
                      .|..+++|+.|++++|.++.+++..+..+++|+.|++++|.+..+.+..|..+.                       .+|
T Consensus       147 ~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L  226 (477)
T 2id5_A          147 AFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNL  226 (477)
T ss_dssp             SSTTCTTCCEEEEESCCCSSCCHHHHTTCTTCCEEEEESCCCCEECTTCSCSCTTCCEEEEECCTTCCEECTTTTTTCCC
T ss_pred             hccCCCCCCEEECCCCcCcccChhHhcccCCCcEEeCCCCcCcEeChhhcccCcccceeeCCCCccccccCcccccCccc
Confidence            899999999999999999988887888888999999998888877665554441                       256


Q ss_pred             cEEEccCCcCcccCcccccCCCCCcEEEccCCcCceeCcCcCCCCCCCCEeecCCCcCcccCcccCCCCCCCcEEeCCCC
Q psy15002        261 KRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGN  340 (357)
Q Consensus       261 ~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~L~~N  340 (357)
                      +.|++++|.++.++...+..+++|++|++++|.++.+++..+.++++|+.|++++|+++++++..+.++++|+.|+|++|
T Consensus       227 ~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N  306 (477)
T 2id5_A          227 TSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGN  306 (477)
T ss_dssp             SEEEEESSCCCSCCHHHHTTCTTCCEEECCSSCCCEECTTSCTTCTTCCEEECCSSCCSEECTTTBTTCTTCCEEECCSS
T ss_pred             cEEECcCCcccccCHHHhcCccccCeeECCCCcCCccChhhccccccCCEEECCCCccceECHHHhcCcccCCEEECCCC
Confidence            66666777788777667888999999999999999999988999999999999999999998888899999999999999


Q ss_pred             cccccCcccccCcccc
Q psy15002        341 HIHTVDPAAFSGLEAK  356 (357)
Q Consensus       341 ~l~~~~~~~~~~l~~l  356 (357)
                      .++++++..|..+++|
T Consensus       307 ~l~~~~~~~~~~l~~L  322 (477)
T 2id5_A          307 QLTTLEESVFHSVGNL  322 (477)
T ss_dssp             CCSCCCGGGBSCGGGC
T ss_pred             cCceeCHhHcCCCccc
Confidence            9999999988887654



>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 357
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 71.2 bits (173), Expect = 1e-14
 Identities = 60/275 (21%), Positives = 98/275 (35%), Gaps = 59/275 (21%)

Query: 134 SSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEG-KALTQLDL 192
             +      L+L  N++T +       L+NL  L L++N+I+ I  G F     L +L L
Sbjct: 27  KDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYL 86

Query: 193 SQNSLAVVPSPALKSLNHL-----------------------LILNLNHNKISALHSNAF 229
           S+N L  +P    K+L  L                       + L  N  K S + + AF
Sbjct: 87  SKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAF 146

Query: 230 QGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSKLENLRKLE- 288
           QG+  L  + I +  ++ I           L  L+L GN++T+V   SL  L NL KL  
Sbjct: 147 QGMKKLSYIRIADTNITTIPQGLPP----SLTELHLDGNKITKVDAASLKGLNNLAKLGL 202

Query: 289 ----------------------LLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVF 326
                                  L+N   +   G       +  + L +N +  I    F
Sbjct: 203 SFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDF 262

Query: 327 A------HLPLLNSLELDGNHIHT--VDPAAFSGL 353
                       + + L  N +    + P+ F  +
Sbjct: 263 CPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCV 297


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.96
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.88
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.86
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.6
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.52
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.49
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.54
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.6
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00  E-value=5.3e-32  Score=238.41  Aligned_cols=285  Identities=22%  Similarity=0.405  Sum_probs=245.1

Q ss_pred             cCCCCCCCCCCceeccccCCeEEecccCChhhHHHHHhhhccCCCceEEEEEecCCCCcCccccccCCC-cccEEEecCC
Q psy15002         45 QQCPPHNEISPCQCSVKKNGLDILCEFTDNQKIQHTMTTLKSKSGLIIFYLKLRHNNLPKLTGFIFFGL-DIRHLTIHNS  123 (357)
Q Consensus        45 ~~Cp~~~~~~~C~C~~~~~~~~~~C~~~~l~~i~~~~~~~~~~~~~~l~~L~l~~~~i~~l~~~~~~~~-~L~~L~l~~~  123 (357)
                      ..||.     .|+|...    .++|++.+++++|..+       +..+++|++++|+|+.++...|... +|++|++++|
T Consensus         2 ~~~p~-----~c~c~~~----~~~C~~~~L~~lP~~l-------~~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~l~~n   65 (305)
T d1xkua_           2 PVCPF-----RCQCHLR----VVQCSDLGLEKVPKDL-------PPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINN   65 (305)
T ss_dssp             CCCCT-----TCEEETT----EEECTTSCCCSCCCSC-------CTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSS
T ss_pred             CCCCC-----CCEecCC----EEEecCCCCCccCCCC-------CCCCCEEECcCCcCCCcChhHhhccccccccccccc
Confidence            47998     6999755    8999999999888543       4678999999999999999888776 9999999999


Q ss_pred             CcceecCcccccccccceEEEccCCcCceeChhhhcCCCCCcEEeccCCccccccCCCCCC-CCCCeEECCCCCCee--e
Q psy15002        124 SLAVVEESSLSSIGKKLKRLNLGGNELTRVPQTSLSKLENLRKLELLHNRIALIEEGDFEG-KALTQLDLSQNSLAV--V  200 (357)
Q Consensus       124 ~l~~~~~~~~~~l~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~-~~L~~L~l~~n~l~~--~  200 (357)
                      .+..+.+.+|..+ ++|++|++++|+++.++..   ..+.++.|++.+|.+..++...+.. ..+..++...+....  .
T Consensus        66 ~~~~i~~~~f~~l-~~L~~L~l~~n~l~~l~~~---~~~~l~~L~~~~n~l~~l~~~~~~~~~~~~~l~~~~n~~~~~~~  141 (305)
T d1xkua_          66 KISKISPGAFAPL-VKLERLYLSKNQLKELPEK---MPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGI  141 (305)
T ss_dssp             CCCCBCTTTTTTC-TTCCEEECCSSCCSBCCSS---CCTTCCEEECCSSCCCBBCHHHHTTCTTCCEEECCSSCCCGGGB
T ss_pred             cccccchhhhhCC-CccCEecccCCccCcCccc---hhhhhhhhhccccchhhhhhhhhhccccccccccccccccccCC
Confidence            9999999999888 6799999999999998864   3467899999999999888776655 677888888876543  3


Q ss_pred             CccccCCCCcCceeecccccCcccCcccCCCCCCCCEEEccCCcCcccCCCccccccccccEEEccCCcCcccCcccccC
Q psy15002        201 PSPALKSLNHLLILNLNHNKISALHSNAFQGLDTLEILTIFENKLSLIEPDSFKGLEKKLKRLNLGGNELTRVPQTSLSK  280 (357)
Q Consensus       201 ~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~  280 (357)
                      ....+..+++|+.+++.+|.+..++...   .++|+.|++++|..+...+..|... +.++.|++++|.++++++..+.+
T Consensus       142 ~~~~~~~l~~L~~l~l~~n~l~~l~~~~---~~~L~~L~l~~n~~~~~~~~~~~~~-~~l~~L~~s~n~l~~~~~~~~~~  217 (305)
T d1xkua_         142 ENGAFQGMKKLSYIRIADTNITTIPQGL---PPSLTELHLDGNKITKVDAASLKGL-NNLAKLGLSFNSISAVDNGSLAN  217 (305)
T ss_dssp             CTTGGGGCTTCCEEECCSSCCCSCCSSC---CTTCSEEECTTSCCCEECTGGGTTC-TTCCEEECCSSCCCEECTTTGGG
T ss_pred             CccccccccccCccccccCCccccCccc---CCccCEEECCCCcCCCCChhHhhcc-ccccccccccccccccccccccc
Confidence            3456788899999999999998875432   5799999999999999888888888 79999999999999999888999


Q ss_pred             CCCCcEEEccCCcCceeCcCcCCCCCCCCEeecCCCcCcccCcccC------CCCCCCcEEeCCCCccc--ccCcccccC
Q psy15002        281 LENLRKLELLHNRIALIEEGDFEGLHNLDSLVLAHNQLRTIPPRVF------AHLPLLNSLELDGNHIH--TVDPAAFSG  352 (357)
Q Consensus       281 l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~------~~~~~L~~L~L~~N~l~--~~~~~~~~~  352 (357)
                      +++|++|++++|+++.++. .+..+++|+.|++++|+|+.++...|      ....+|+.|+|++|+|+  .++|..|..
T Consensus       218 l~~L~~L~L~~N~L~~lp~-~l~~l~~L~~L~Ls~N~i~~i~~~~f~~~~~~~~~~~L~~L~L~~N~~~~~~~~~~~f~~  296 (305)
T d1xkua_         218 TPHLRELHLNNNKLVKVPG-GLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRC  296 (305)
T ss_dssp             STTCCEEECCSSCCSSCCT-TTTTCSSCCEEECCSSCCCCCCTTSSSCSSCCTTSCCCSEEECCSSSSCGGGSCGGGGTT
T ss_pred             cccceeeeccccccccccc-ccccccCCCEEECCCCccCccChhhccCcchhcccCCCCEEECCCCcCccCcCCHhHhcc
Confidence            9999999999999999976 68889999999999999999876554      34578999999999886  688888877


Q ss_pred             cc
Q psy15002        353 LE  354 (357)
Q Consensus       353 l~  354 (357)
                      +.
T Consensus       297 ~~  298 (305)
T d1xkua_         297 VY  298 (305)
T ss_dssp             CC
T ss_pred             cc
Confidence            54



>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure