Diaphorina citri psyllid: psy15011

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----

MENAWSMKIPEFKKEDNPHEYLKECWPLVKNALELHFIKAELDVIEGSMTVFTTRKTWDPYIIIKARDMIKLLSRSVPYEPLKEEYLKECWPLVKNALELHFIKAELDVIEGSMTVFTTRKTWDPYIIIKARDMIKLLSRSVPYEQAVRVLQDDISCDIIKIGNLVQNKQRFVKRRQRLIGPNGCTLKSIELLTNCYMLVQGQTVAALGPHKGLLQSNIGPNGCTLKSIELLTNCYMLVQGQTVAALGPHKGLLQVRRIVEDTMKNIHPIYNIKALMIKRELAKDPKLKNENWERFLPNFKSKTLSKRKMPKKRKTKSEYTPFPPPQPESEANS

cccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEccccccEEEEccccccccHHHHHccccccccEEEECccccHHHHHHHHHHHHHHHHHHccEEEEEEccccEEEEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHHcccEEEEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHcEEEEEEccEEEEEccccccccccccccccHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccHHHHccccccccccccccccccccccccccccccccc

**NAWSMKIPEFKKEDNPHEYLKECWPLVKNALELHFIKAELDVIEGSMTVFTTRKTWDPYIIIKARDMIKLLSRSVPYEPLKEEYLKECWPLVKNALELHFIKAELDVIEGSMTVFTTRKTWDPYIIIKARDMIKLLSRSVPYEQAVRVLQDDISCDIIKIGNLVQNKQRFVKRRQRLIGPNGCTLKSIELLTNCYMLVQGQTVAALGPHKGLLQSNIGPNGCTLKSIELLTNCYMLVQGQTVAALGPHKGLLQVRRIVEDTMKNIHPIYNIKALMIKRELAK*******NWERFL*************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
KRR1 small subunit processome component	Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. Essential for vegetative growth.	confident	P25586
KRR1 small subunit processome component homolog	Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.	confident	O74777
KRR1 small subunit processome component homolog	Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. Binds to RNA. Required for female germline development, cell viability during eye development and for survival of dividing cells and epithelial cells during early wing disk development.	confident	Q9VPU8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006364 [BP]	rRNA processing	probable	GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0030686 [CC]	90S preribosome	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0032040 [CC]	small-subunit processome	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E3U, chain A
Confidence level:very confident
Coverage over the Query: 74-199,239-278
View the alignment between query and template
View the model in PyMOL

Template: 2E3U, chain A
Confidence level:very confident
Coverage over the Query: 19-152
View the alignment between query and template
View the model in PyMOL

Template: 2BL5, chain A
Confidence level:confident
Coverage over the Query: 175-212,225-293
View the alignment between query and template
View the model in PyMOL