Diaphorina citri psyllid: psy15026


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
WRHVRIQQNGKNASGQTHYLSLSGFEIYGTLTGVCEDLGRAAREAEASVRKARRLVRTQVMRHLIIGARVQRGLDWKWRDQDGIPPGEGNLKPIIMII
cCEEEEEEccccccccEEEEEEEEEEEEccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccEEEEEEEc
*RHVR***********THYLSLSGFEIYGTLTGVCEDLGR**********KARRLVRTQVMRHLIIGARVQRGLDWKWRDQDGIPPGEGNLKPIIMII
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WRHVRIQQNGKNASGQTHYLSLSGFEIYGTLTGVxxxxxxxxxxxxxxxxxxxxxVRTQVMRHLIIGARVQRGLDWKWRDQDGIPPGEGNLKPIIMII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase HECTD1 Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in development of the head mesenchyme and neural tube closure.confidentQ69ZR2
E3 ubiquitin-protein ligase HECTD1 Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. May be required for development of the head mesenchyme and neural tube closure.confidentQ9ULT8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001843 [BP]neural tube closureprobableGO:0032502, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009792, GO:0021915, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0001841, GO:0060562, GO:0043009, GO:0048646, GO:0048598, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0060606, GO:0008150, GO:0035295, GO:0001838, GO:0014020, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048731
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042787 [BP]protein ubiquitination involved in ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0070647, GO:0032446, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0006511

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DKM, chain A
Confidence level:very confident
Coverage over the Query: 53-94
View the alignment between query and template
View the model in PyMOL
Template: 3F2Z, chain A
Confidence level:probable
Coverage over the Query: 2-33
View the alignment between query and template
View the model in PyMOL