Diaphorina citri psyllid: psy15032

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MSISTAFAHRHRVFAPYLLYQIQMKGIKKITLKHSINICALRIFHQESSTILVCFHKENYPFCTNFHCYLKLFSVVPRNFRLLEELEHGQRGVGDGTISWGLENDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGPRYPDEPPQCRFVSRINMTCINNTSGIVVVIMFWVMIEAKATHYPVDLKTGTPDQVYLIVCVLIRYQVDLTDRPFQPYLSGLPDSEWLA
ccHHHHHHHHcccHHHHHHHHHHHccEEEEEEcccccccHHHHEEccccEEEEEEEcccccccccHHHHHHHccccHHHHHHHHHHHHHHcccccccEEEEccccccccCEEEEEEEEccccccccccEEEEEEECccccccccccEEEEEccccccccccccEEEEEEccHHHcccccccHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccccccc
*****AFAHRHRVFAPYLLYQIQMKGIKKITLKHSINICALRIFHQESSTILVCFHKENYPFCTNFHCYLKLFSVVPRNFRLLEELEHGQRGVGDGTISWGLENDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGPRYPDEPPQCRFVSRINMTCINNTSGIVVVIMFWVMIEAKATHYPVDLKTGTPDQVYLIVCVLIRYQVDLTDRPFQPYLSGLP*SEWL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSISTAFAHRHRVFAPYLLYQIQMKGIKKITLKHSINICALRIFHQESSTILVCFHKENYPFCTNFHCYLKLFSVVPRNFRLLEELEHGQRGVGDGTISWGLENDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGPRYPDEPPQCRFVSRINMTCINNTSGIVVVIMFWVMIEAKATHYPVDLKTGTPDQVYLIVCVLIRYQVDLTDRPFQPYLSGLPDSEWLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 variant 2 Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.confidentQ15819
Ubiquitin-conjugating enzyme E2 variant 2 Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.confidentQ3SZ43
Ubiquitin-conjugating enzyme E2 variant 2 Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.confidentQ7M767

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070534 [BP]protein K63-linked ubiquitinationconfidentGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0031371 [CC]ubiquitin conjugating enzyme complexconfidentGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0031372 [CC]UBC13-MMS2 complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031371
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000151 [CC]ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0035370 [CC]UBC13-UEV1A complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031371
GO:0008063 [BP]Toll signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0032436 [BP]positive regulation of proteasomal ubiquitin-dependent protein catabolic processprobableGO:0009896, GO:0009894, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:1901800, GO:0048518, GO:0065007, GO:0060255, GO:0031331, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0061136, GO:0045862, GO:0048522
GO:0070936 [BP]protein K48-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0034142 [BP]toll-like receptor 4 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0006511 [BP]ubiquitin-dependent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0043524 [BP]negative regulation of neuron apoptotic processprobableGO:0010941, GO:0060548, GO:0043066, GO:0050794, GO:0008150, GO:0043067, GO:0043523, GO:0065007, GO:0048523, GO:0048519, GO:1901214, GO:1901215, GO:0042981, GO:0050789, GO:0043069
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0045087 [BP]innate immune responseprobableGO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955
GO:0051965 [BP]positive regulation of synapse assemblyprobableGO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0051128, GO:0023052, GO:0050789, GO:0044699, GO:0044087, GO:0065007, GO:0048518, GO:0065008, GO:0051130, GO:0032501, GO:0050793, GO:0050877, GO:0009987, GO:0050794, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051094, GO:0051963, GO:0051962, GO:0051960, GO:2000026, GO:0044763, GO:0044089, GO:0048522
GO:0043123 [BP]positive regulation of I-kappaB kinase/NF-kappaB cascadeprobableGO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043122, GO:0048522
GO:0002755 [BP]MyD88-dependent toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0042275 [BP]error-free postreplication DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0006301, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0010994 [BP]free ubiquitin chain polymerizationprobableGO:0051258, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0032844, GO:0065003, GO:0044085, GO:0065007, GO:0071840, GO:0034622, GO:0008150, GO:0050794, GO:0043623, GO:0050789, GO:0010993
GO:0034138 [BP]toll-like receptor 3 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034134 [BP]toll-like receptor 2 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034130 [BP]toll-like receptor 1 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0050852 [BP]T cell receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0002764, GO:0002768, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0050851, GO:0002757, GO:0009987, GO:0050794, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002429, GO:0050896, GO:0050778, GO:0002376, GO:0002253, GO:0044763
GO:0070423 [BP]nucleotide-binding oligomerization domain containing signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0035556, GO:0050789, GO:0044699, GO:0051716, GO:0030522, GO:0002764, GO:0035872, GO:0002684, GO:0065007, GO:0031347, GO:0048518, GO:0002682, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0050776, GO:0044763, GO:0007154, GO:0044700, GO:0002757, GO:0002753, GO:0050896, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0008150, GO:0080134
GO:0045739 [BP]positive regulation of DNA repairprobableGO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0006282, GO:0051052, GO:0060255, GO:0048583, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:2001020, GO:2001022, GO:0080134, GO:0080135, GO:0048522
GO:0070979 [BP]protein K11-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0000729 [BP]DNA double-strand break processingprobableGO:0044238, GO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:0051716, GO:0044265, GO:0006302, GO:0044260, GO:0006308, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:1901575, GO:0046700, GO:0006974, GO:0006259, GO:0006950, GO:0044763, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0000738, GO:0044270, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0019439, GO:0008150
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0051092 [BP]positive regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044093, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051091, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0010976 [BP]positive regulation of neuron projection developmentprobableGO:0032502, GO:0010975, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0031346, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0048518, GO:0051130, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A4D, chain A
Confidence level:very confident
Coverage over the Query: 73-214
View the alignment between query and template
View the model in PyMOL