Diaphorina citri psyllid: psy15037


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MNEGEDGCKRIGCTECGFVFCKDCLQGAHIGPCDPGRTSMDQGGASTSDYAVDPTRASQDCLQGAHIGPCDPERTSMDQGGASTSDYAVDPTRASQARWDDASQVTIKVSTKPCPSCRTATERAGKGVYAYDLYPMFIPLVLGVSSGME
cccccccccEEEEccccEEECccccccccccccccccccccccccccccccccccHHcHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccECcccEEEEECcccHHHHHHHHcccccc
*******CKRIGCTECGFVFCKDCLQGAHIGPCD*************SDYAVDPTRASQDCLQGAHIGPC**********************************VTIKVSTKPCPSCRTATERAGKGVYAYDLYPMFIPLVLGVSSG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEGEDGCKRIGCTECGFVFCKDCLQGAHIGPCDPGRTSMDQGGASTSDYAVDPTRASQDCLQGAHIGPCDPERTSMDQGGASTSDYAVDPTRASQARWDDASQVTIKVSTKPCPSCRTATERAGKGVYAYDLYPMFIPLVLGVSSGME

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0046329 [BP]negative regulation of JNK cascadeprobableGO:0048585, GO:0048583, GO:0023057, GO:0010648, GO:0023051, GO:0046328, GO:0010646, GO:0010627, GO:0050789, GO:0043409, GO:0043408, GO:0009968, GO:0009966, GO:0065007, GO:0048519, GO:0010741, GO:0070302, GO:0070303, GO:0050794, GO:0032872, GO:0032873, GO:0008150, GO:0080134, GO:0080135, GO:0048523
GO:1900407 [BP]regulation of cellular response to oxidative stressprobableGO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051865 [BP]protein autoubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JMO, chain A
Confidence level:confident
Coverage over the Query: 5-36
View the alignment between query and template
View the model in PyMOL
Template: 1WD2, chain A
Confidence level:confident
Coverage over the Query: 106-134
View the alignment between query and template
View the model in PyMOL