Diaphorina citri psyllid: psy15038


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-------
VCCGGDLPEVEIISLLEEQLPQYKLRADTLTEFIGYENQDWFVPCPLQADDPTALTPDQIRETLNYF
ccccccccHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccHHHHHHHHccc
***GGDLPEVEIISLLEEQLPQYKLRADTLTEFIGYENQDWFVPCPLQA********DQIRETLNYF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VCCGGDLPEVEIISLLEEQLPQYKLRADTLTEFIGYENQDWFVPCPLQADDPTALTPDQIRETLNYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trafficking kinesin-binding protein 1 Involved in the regulation of endosome-to-lysosome trafficking, including endocytic trafficking of EGF-EGFR complexes and GABA-A receptors.confidentQ9UPV9
Trafficking kinesin-binding protein 1 Involved in the regulation of endosome-to-lysosome trafficking, including endocytic of EGF-EGFR complexes and GABA-A receptors.confidentQ6PD31

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006605 [BP]protein targetingprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0051641
GO:0050811 [MF]GABA receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0008333 [BP]endosome to lysosome transportprobableGO:0016197, GO:0051234, GO:0046907, GO:0007034, GO:0006810, GO:0044765, GO:0008150, GO:0007041, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006493 [BP]protein O-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted