Diaphorina citri psyllid: psy15044


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MEVRDPPEAKEKEGPRNFSWIVPDELAAMACPDTRDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPVEEYHAPTMRQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAITTLRLARPGSLECHFCNKEEI
ccccccHHHHHcccccccCEEEcccEEEEcccccHHHHHHHHHccccEEEEccccccccccccccccCEEEccccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccc
*EVRDPPEAKEKEGPRNFSWIVPDELAAMACPDTRDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPVEEYHAPTMRQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAITTLRLARPGSLECHFC*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVRDPPEAKEKEGPRNFSWIVPDELAAMACPDTRDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPVEEYHAPTMRQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAITTLRLARPGSLECHFCNKEEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual specificity protein phosphatase 23 Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).confidentQ6NT99
Dual specificity protein phosphatase 23 Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).confidentQ9BVJ7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016311 [BP]dephosphorylationprobableGO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0008138 [MF]protein tyrosine/serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005815 [CC]microtubule organizing centerprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004725 [MF]protein tyrosine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable
3.1.3.48Protein-tyrosine-phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IMG, chain A
Confidence level:very confident
Coverage over the Query: 12-152
View the alignment between query and template
View the model in PyMOL