Psyllid ID: psy15044
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 154 | 2.2.26 [Sep-21-2011] | |||||||
| Q9BVJ7 | 150 | Dual specificity protein | yes | N/A | 0.857 | 0.88 | 0.398 | 4e-19 | |
| Q6NT99 | 150 | Dual specificity protein | yes | N/A | 0.857 | 0.88 | 0.390 | 7e-19 | |
| Q9ZQP1 | 337 | Putative dual specificity | yes | N/A | 0.863 | 0.394 | 0.307 | 2e-10 | |
| Q196Z3 | 240 | Putative tyrosine phospha | N/A | N/A | 0.759 | 0.487 | 0.291 | 2e-09 | |
| A6N3Q4 | 483 | Dual specificity protein | N/A | N/A | 0.837 | 0.267 | 0.273 | 3e-09 | |
| Q6PFY9 | 485 | Dual specificity protein | no | N/A | 0.850 | 0.270 | 0.264 | 6e-09 | |
| O60729 | 498 | Dual specificity protein | no | N/A | 0.850 | 0.263 | 0.257 | 2e-08 | |
| Q6NZK8 | 747 | Protein tyrosine phosphat | no | N/A | 0.454 | 0.093 | 0.366 | 3e-08 | |
| A2A3K4 | 754 | Protein tyrosine phosphat | no | N/A | 0.454 | 0.092 | 0.352 | 4e-08 | |
| A7E379 | 796 | Protein tyrosine phosphat | no | N/A | 0.454 | 0.087 | 0.352 | 4e-08 |
| >sp|Q9BVJ7|DUS23_HUMAN Dual specificity protein phosphatase 23 OS=Homo sapiens GN=DUSP23 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 93.6 bits (231), Expect = 4e-19, Method: Compositional matrix adjust.
Identities = 53/133 (39%), Positives = 72/133 (54%), Gaps = 1/133 (0%)
Query: 15 PRNFSWIVPDELAAMACPDTRDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPV 74
P NFSW++P LA +A P H + L GV HLVSL+E P + L + +
Sbjct: 5 PPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHS-DSCPGLTLHRLRI 63
Query: 75 EEYHAPTMRQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAIT 134
++ P Q+ +F++ +GEAVGVHC G GRTG M ACYLV G+ AI
Sbjct: 64 PDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIA 123
Query: 135 TLRLARPGSLECH 147
+R RPGS+E +
Sbjct: 124 EIRRLRPGSIETY 136
|
Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14). Homo sapiens (taxid: 9606) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8 |
| >sp|Q6NT99|DUS23_MOUSE Dual specificity protein phosphatase 23 OS=Mus musculus GN=Dusp23 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ZQP1|DSP8_ARATH Putative dual specificity protein phosphatase DSP8 OS=Arabidopsis thaliana GN=DSP8 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q196Z3|VF197_IIV3 Putative tyrosine phosphatase 067L OS=Invertebrate iridescent virus 3 GN=IIV3-067L PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A6N3Q4|CC14C_HYLSY Dual specificity protein phosphatase CDC14C OS=Hylobates syndactylus GN=CDC14C PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q6PFY9|CC14B_MOUSE Dual specificity protein phosphatase CDC14B OS=Mus musculus GN=Cdc14b PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O60729|CC14B_HUMAN Dual specificity protein phosphatase CDC14B OS=Homo sapiens GN=CDC14B PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6NZK8|PTPC1_MOUSE Protein tyrosine phosphatase domain-containing protein 1 OS=Mus musculus GN=Ptpdc1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A2A3K4|PTPC1_HUMAN Protein tyrosine phosphatase domain-containing protein 1 OS=Homo sapiens GN=PTPDC1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A7E379|PTPC1_BOVIN Protein tyrosine phosphatase domain-containing protein 1 OS=Bos taurus GN=PTPDC1 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 154 | ||||||
| 357627912 | 276 | putative dual specificity phosphatase 23 | 0.870 | 0.485 | 0.507 | 2e-31 | |
| 357627911 | 227 | putative dual specificity phosphatase 23 | 0.831 | 0.563 | 0.458 | 3e-28 | |
| 389609905 | 227 | unknown unsecreted protein [Papilio xuth | 0.935 | 0.634 | 0.430 | 1e-26 | |
| 321475499 | 156 | hypothetical protein DAPPUDRAFT_208196 [ | 0.844 | 0.833 | 0.442 | 9e-23 | |
| 72111445 | 155 | PREDICTED: dual specificity protein phos | 0.844 | 0.838 | 0.401 | 2e-21 | |
| 291235004 | 153 | PREDICTED: dual specificity phosphatase | 0.857 | 0.862 | 0.395 | 1e-20 | |
| 443724251 | 166 | hypothetical protein CAPTEDRAFT_181889 [ | 0.850 | 0.789 | 0.410 | 8e-20 | |
| 432119437 | 168 | Dual specificity protein phosphatase 23 | 0.857 | 0.785 | 0.413 | 1e-19 | |
| 260829319 | 154 | hypothetical protein BRAFLDRAFT_125025 [ | 0.863 | 0.863 | 0.4 | 4e-19 | |
| 417396265 | 150 | Putative dual specificity protein phosph | 0.857 | 0.88 | 0.413 | 5e-19 |
| >gi|357627912|gb|EHJ77433.1| putative dual specificity phosphatase 23-like protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 140 bits (353), Expect = 2e-31, Method: Compositional matrix adjust.
Identities = 72/142 (50%), Positives = 91/142 (64%), Gaps = 8/142 (5%)
Query: 15 PRNFSWIVPDELAAMACPDTRDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPV 74
P NFSW+V +++A M CP + L L+ G+ L++LS E IP +E L W I +
Sbjct: 39 PINFSWLVDNKIAGMGCPQSVASLNYLADVGINQLITLSPEKIPPLLECDINLKWTEIRI 98
Query: 75 EEYHAPTMRQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAIT 134
+E+ APT++Q+IKFIE C +GEAVGVHCR GRGRTG M ACYLV F MTPERAI
Sbjct: 99 KEFGAPTLKQIIKFIEICERADIRGEAVGVHCRHGRGRTGTMLACYLVCFKRMTPERAIL 158
Query: 135 TLRLARPGSLE--------CHF 148
T+R RPGS E CH+
Sbjct: 159 TVRTMRPGSCETAEQQQMVCHY 180
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357627911|gb|EHJ77432.1| putative dual specificity phosphatase 23-like protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|389609905|dbj|BAM18564.1| unknown unsecreted protein [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|321475499|gb|EFX86462.1| hypothetical protein DAPPUDRAFT_208196 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|72111445|ref|XP_789793.1| PREDICTED: dual specificity protein phosphatase 23-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|291235004|ref|XP_002737435.1| PREDICTED: dual specificity phosphatase 23-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|443724251|gb|ELU12352.1| hypothetical protein CAPTEDRAFT_181889 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|432119437|gb|ELK38512.1| Dual specificity protein phosphatase 23 [Myotis davidii] | Back alignment and taxonomy information |
|---|
| >gi|260829319|ref|XP_002609609.1| hypothetical protein BRAFLDRAFT_125025 [Branchiostoma floridae] gi|229294971|gb|EEN65619.1| hypothetical protein BRAFLDRAFT_125025 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|417396265|gb|JAA45166.1| Putative dual specificity protein phosphatase 23 [Desmodus rotundus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 154 | ||||||
| RGD|1309202 | 150 | Dusp23 "dual specificity phosp | 0.857 | 0.88 | 0.398 | 3.5e-20 | |
| UNIPROTKB|Q9BVJ7 | 150 | DUSP23 "Dual specificity prote | 0.857 | 0.88 | 0.398 | 5.7e-20 | |
| ZFIN|ZDB-GENE-030131-2554 | 181 | si:dkeyp-95d10.1 "si:dkeyp-95d | 0.844 | 0.718 | 0.396 | 5.7e-20 | |
| MGI|MGI:1915690 | 150 | Dusp23 "dual specificity phosp | 0.857 | 0.88 | 0.390 | 1.2e-19 | |
| UNIPROTKB|A3KN00 | 150 | DUSP23 "Uncharacterized protei | 0.857 | 0.88 | 0.390 | 1.9e-19 | |
| UNIPROTKB|I3LTD4 | 151 | DUSP23 "Uncharacterized protei | 0.857 | 0.874 | 0.390 | 3.1e-19 | |
| ZFIN|ZDB-GENE-040718-163 | 152 | zgc:92902 "zgc:92902" [Danio r | 0.844 | 0.855 | 0.381 | 3.6e-18 | |
| UNIPROTKB|Q0DGM1 | 377 | Os05g0524200 "Os05g0524200 pro | 0.792 | 0.323 | 0.325 | 1.9e-13 | |
| UNIPROTKB|Q5JNL3 | 341 | P0638D12.17 "Putative PTEN-lik | 0.753 | 0.340 | 0.307 | 1.8e-12 | |
| TAIR|locus:2058699 | 337 | AT2G35680 "AT2G35680" [Arabido | 0.733 | 0.335 | 0.325 | 1.4e-11 |
| RGD|1309202 Dusp23 "dual specificity phosphatase 23" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 239 (89.2 bits), Expect = 3.5e-20, P = 3.5e-20
Identities = 53/133 (39%), Positives = 72/133 (54%)
Query: 15 PRNFSWIVPDELAAMACPDTRDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPV 74
P NFSW++P LA +A P H + L GV HLVSL+E P + L + +
Sbjct: 5 PPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHS-DSCPGLTLHRLRI 63
Query: 75 EEYHAPTMRQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAIT 134
++ P Q+ +F++ +GEAVGVHC G GRTG M ACYLV G+ AI
Sbjct: 64 PDFCPPAPEQIDQFVKIVDEANARGEAVGVHCALGFGRTGTMLACYLVKEQGLAAGEAIA 123
Query: 135 TLRLARPGSLECH 147
+R RPGS+E +
Sbjct: 124 EIRRLRPGSIETY 136
|
|
| UNIPROTKB|Q9BVJ7 DUSP23 "Dual specificity protein phosphatase 23" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-2554 si:dkeyp-95d10.1 "si:dkeyp-95d10.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915690 Dusp23 "dual specificity phosphatase 23" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A3KN00 DUSP23 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LTD4 DUSP23 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-163 zgc:92902 "zgc:92902" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0DGM1 Os05g0524200 "Os05g0524200 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5JNL3 P0638D12.17 "Putative PTEN-like phosphatase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058699 AT2G35680 "AT2G35680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q6NT99 | DUS23_MOUSE | 3, ., 1, ., 3, ., 4, 8 | 0.3909 | 0.8571 | 0.88 | yes | N/A |
| Q9BVJ7 | DUS23_HUMAN | 3, ., 1, ., 3, ., 4, 8 | 0.3984 | 0.8571 | 0.88 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3 | 0.766 |
| 3rd Layer | 3.1.3.16 | 0.824 |
| 3rd Layer | 3.1.3.48 | 0.824 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 154 | |||
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 6e-14 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 2e-12 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 4e-12 | |
| PRK12361 | 547 | PRK12361, PRK12361, hypothetical protein; Provisio | 2e-07 | |
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 5e-07 | |
| PTZ00393 | 241 | PTZ00393, PTZ00393, protein tyrosine phosphatase; | 3e-06 | |
| PTZ00242 | 166 | PTZ00242, PTZ00242, protein tyrosine phosphatase; | 3e-05 | |
| COG2365 | 249 | COG2365, COG2365, Protein tyrosine/serine phosphat | 0.001 |
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
Score = 64.2 bits (157), Expect = 6e-14
Identities = 23/102 (22%), Positives = 47/102 (46%), Gaps = 10/102 (9%)
Query: 45 GVCHLVSLSEECIPDGIERYEPLNWILIPVEEYH----APTMRQVIKFIEFCVNCRQKGE 100
G+ H+++++ E + L +P+++ +P + ++FIE + KG
Sbjct: 26 GITHVINVTNEVPNYNGSDFTYLG---VPIDDNTETKISPYFPEAVEFIE---DAESKGG 79
Query: 101 AVGVHCRSGRGRTGVMAACYLVYFLGMTPERAITTLRLARPG 142
V VHC++G R+ + YL+ M+ A ++ RP
Sbjct: 80 KVLVHCQAGVSRSATLIIAYLMKTRNMSLNDAYDFVKDRRPI 121
|
Length = 138 |
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|240399 PTZ00393, PTZ00393, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185524 PTZ00242, PTZ00242, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225240 COG2365, COG2365, Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 154 | |||
| KOG1720|consensus | 225 | 99.97 | ||
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.97 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.97 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.96 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.96 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.95 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.94 | |
| KOG1719|consensus | 183 | 99.92 | ||
| KOG1717|consensus | 343 | 99.9 | ||
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.9 | |
| KOG1718|consensus | 198 | 99.89 | ||
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.89 | |
| KOG1716|consensus | 285 | 99.89 | ||
| KOG2836|consensus | 173 | 99.86 | ||
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.82 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.82 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 99.74 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 99.72 | |
| PLN02727 | 986 | NAD kinase | 99.7 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.7 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.7 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 99.69 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 99.67 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 99.65 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 99.62 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 99.62 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 99.6 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 99.57 | |
| KOG2283|consensus | 434 | 99.56 | ||
| KOG1572|consensus | 249 | 99.56 | ||
| KOG0792|consensus | 1144 | 99.55 | ||
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 99.54 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 99.53 | |
| KOG0790|consensus | 600 | 99.43 | ||
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 99.38 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 99.31 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 99.28 | |
| KOG0793|consensus | 1004 | 99.19 | ||
| KOG0791|consensus | 374 | 99.17 | ||
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 99.12 | |
| KOG0789|consensus | 415 | 99.05 | ||
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 99.0 | |
| KOG4228|consensus | 1087 | 98.97 | ||
| KOG2386|consensus | 393 | 98.95 | ||
| KOG4228|consensus | 1087 | 98.89 | ||
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 97.54 | |
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 97.38 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 97.27 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 96.71 | |
| KOG4471|consensus | 717 | 96.63 | ||
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 96.0 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 95.75 | |
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 95.55 | |
| PRK01415 | 247 | hypothetical protein; Validated | 95.55 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 95.54 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 95.26 | |
| KOG1089|consensus | 573 | 95.09 | ||
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 95.06 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 94.97 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 94.77 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 94.4 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 94.28 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 94.26 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 94.23 | |
| KOG1530|consensus | 136 | 94.22 | ||
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 93.05 | |
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 91.15 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 90.42 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 90.37 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 90.2 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 90.04 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 89.82 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 89.62 | |
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 89.01 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 87.9 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 87.61 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 87.42 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 87.17 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 86.49 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 86.24 | |
| PRK07411 | 390 | hypothetical protein; Validated | 85.37 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 83.83 | |
| PRK01269 | 482 | tRNA s(4)U8 sulfurtransferase; Provisional | 82.89 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 82.35 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 80.74 |
| >KOG1720|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.6e-31 Score=184.74 Aligned_cols=141 Identities=30% Similarity=0.498 Sum_probs=127.8
Q ss_pred hcCCCCceeEeecCceeeecCCCC--------------HHHHHHHHHCCCcEEEEcCCCCcCCCcccCCCCeEEEeecCC
Q psy15044 11 EKEGPRNFSWIVPDELAAMACPDT--------------RDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPVEE 76 (154)
Q Consensus 11 ~~~~~~~~~~i~~~~~~~~~~p~~--------------~~~~~~l~~~gi~~Vv~l~~~~~~~~~~~~~~~~~~~~p~~d 76 (154)
+.....+|+||.|+++.....|.. ...+..++..++++++.|....|+...+...|+.++++++.|
T Consensus 46 e~ve~gdfnwI~p~~~i~f~~p~~~s~gi~~~f~~~~~~~~~~~~~~~~v~s~vrln~~~yd~~~f~~~Gi~h~~l~f~D 125 (225)
T KOG1720|consen 46 EAVENGDFNWIIPDRFIAFAGPHLKSRGIESGFPLHLPQPYIQYFKNNNVTSIVRLNKRLYDAKRFTDAGIDHHDLFFAD 125 (225)
T ss_pred eccCCCCcceeccchhhhhcCccccccchhhcccccCChhHHHHhhhcccceEEEcCCCCCChHHhcccCceeeeeecCC
Confidence 566789999999998777766632 244677888899999999999877777788899999999999
Q ss_pred CCCCCHHHHHHHHHHHHHHHhCCCcEEEeCCCCCChHHHHHHHHHHHHcCCCHHHHHHHHHHhCCCCCCCcccccc
Q psy15044 77 YHAPTMRQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAITTLRLARPGSLECHFCNKE 152 (154)
Q Consensus 77 ~~~p~~~~~~~~~~~i~~~~~~~~~vlVHC~~G~~Rsg~~~a~~l~~~~g~~~~~a~~~~r~~Rp~~i~~~~q~k~ 152 (154)
+..|+++.+.+|++.+++..+ +++|.|||.+|.||||+++|||||+.+|+++.||++++|..||++|++++|.+-
T Consensus 126 g~tP~~~~v~~fv~i~e~~~~-~g~iaVHCkaGlGRTG~liAc~lmy~~g~ta~eaI~~lR~~RpG~V~gpqQ~~l 200 (225)
T KOG1720|consen 126 GSTPTDAIVKEFVKIVENAEK-GGKIAVHCKAGLGRTGTLIACYLMYEYGMTAGEAIAWLRICRPGAVIGPQQHKL 200 (225)
T ss_pred CCCCCHHHHHHHHHHHHHHHh-cCeEEEEeccCCCchhHHHHHHHHHHhCCCHHHHHHHHHhcCCccccCHHHHHH
Confidence 999999999999999999988 899999999999999999999999999999999999999999999999999874
|
|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1719|consensus | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >KOG1718|consensus | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >KOG1572|consensus | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG2386|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG4471|consensus | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG1089|consensus | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >KOG1530|consensus | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 154 | ||||
| 4erc_A | 150 | Structure Of Vhz Bound To Metavanadate Length = 150 | 4e-20 | ||
| 2img_A | 151 | Crystal Structure Of Dual Specificity Protein Phosp | 2e-19 | ||
| 1ohc_A | 348 | Structure Of The Proline Directed Phosphatase Cdc14 | 9e-10 | ||
| 1ohe_A | 348 | Structure Of Cdc14b Phosphatase With A Peptide Liga | 8e-09 | ||
| 2i6i_A | 161 | Crystal Structures Of The Archaeal Sulfolobus Ptp-F | 4e-07 | ||
| 3rgo_A | 157 | Crystal Structure Of Ptpmt1 Length = 157 | 1e-06 | ||
| 2dxp_A | 161 | Crystal Structure Of The Complex Of The Archaeal Su | 3e-06 | ||
| 3rgq_A | 156 | Crystal Structure Of Ptpmt1 In Complex With Pi(5)p | 9e-06 | ||
| 1wrm_A | 165 | Crystal Structure Of Jsp-1 Length = 165 | 6e-05 | ||
| 1yn9_A | 169 | Crystal Structure Of Baculovirus Rna 5'-Phosphatase | 6e-05 | ||
| 1i9s_A | 210 | Crystal Structure Of The Rna Triphosphatase Domain | 7e-05 | ||
| 2c46_A | 241 | Crystal Structure Of The Human Rna Guanylyltransfer | 8e-05 | ||
| 1i9t_A | 210 | Crystal Structure Of The Oxidized Rna Triphosphatas | 8e-04 |
| >pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 | Back alignment and structure |
|
| >pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 23 From Homo Sapiens In Complex With Ligand Malate Ion Length = 151 | Back alignment and structure |
| >pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 | Back alignment and structure |
| >pdb|1OHE|A Chain A, Structure Of Cdc14b Phosphatase With A Peptide Ligand Length = 348 | Back alignment and structure |
| >pdb|2I6I|A Chain A, Crystal Structures Of The Archaeal Sulfolobus Ptp-Fold Phosphatase Length = 161 | Back alignment and structure |
| >pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 | Back alignment and structure |
| >pdb|2DXP|A Chain A, Crystal Structure Of The Complex Of The Archaeal Sulfolobus Ptp-Fold Phosphatase With Phosphopeptides A-(P)y-R Length = 161 | Back alignment and structure |
| >pdb|3RGQ|A Chain A, Crystal Structure Of Ptpmt1 In Complex With Pi(5)p Length = 156 | Back alignment and structure |
| >pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 | Back alignment and structure |
| >pdb|1YN9|A Chain A, Crystal Structure Of Baculovirus Rna 5'-Phosphatase Complexed With Phosphate Length = 169 | Back alignment and structure |
| >pdb|1I9S|A Chain A, Crystal Structure Of The Rna Triphosphatase Domain Of Mouse Mrna Capping Enzyme Length = 210 | Back alignment and structure |
| >pdb|2C46|A Chain A, Crystal Structure Of The Human Rna Guanylyltransferase And 5'-Phosphatase Length = 241 | Back alignment and structure |
| >pdb|1I9T|A Chain A, Crystal Structure Of The Oxidized Rna Triphosphatase Domain Of Mouse Mrna Capping Enzyme Length = 210 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
Score = 146 bits (371), Expect = 3e-46
Identities = 53/131 (40%), Positives = 70/131 (53%), Gaps = 1/131 (0%)
Query: 15 PRNFSWIVPDELAAMACPDTRDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPV 74
P NFSW++P LA +A P H + L GV HLVSL+E P L + +
Sbjct: 6 PPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSC-PGLTLHRLRI 64
Query: 75 EEYHAPTMRQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAIT 134
++ P Q+ +F++ +GEAVGVHC G GRTG M ACYLV G+ AI
Sbjct: 65 PDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIA 124
Query: 135 TLRLARPGSLE 145
+R RPGS+E
Sbjct: 125 EIRRLRPGSIE 135
|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 154 | |||
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 100.0 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 100.0 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.97 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.97 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.97 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.97 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.97 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 99.97 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.97 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.97 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.97 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.97 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.97 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.97 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.97 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.97 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.96 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.96 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.96 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.96 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.96 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.96 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.96 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.96 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.95 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.95 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.95 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.95 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.95 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.95 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.95 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.95 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.94 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.93 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.89 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.89 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.88 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.87 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.77 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 99.77 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 99.76 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 99.75 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 99.75 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 99.75 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 99.75 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 99.74 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 99.73 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 99.73 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 99.72 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 99.71 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 99.71 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 99.71 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 99.7 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 99.7 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 99.7 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 99.7 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 99.69 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 99.69 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 99.69 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 99.68 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 99.67 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.66 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 99.66 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 99.66 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.65 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.65 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 99.64 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 99.64 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 99.64 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 99.64 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 99.63 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 99.63 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 99.63 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 99.62 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 99.62 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 99.6 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 99.6 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.59 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 99.57 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 99.46 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.44 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.44 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 99.42 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 97.97 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 95.85 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 95.55 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 95.43 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 95.17 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 95.08 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 95.02 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 94.88 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 94.0 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 93.86 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 93.6 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 93.57 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 93.19 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 93.04 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 92.76 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 92.23 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 91.96 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 90.52 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 90.42 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 89.45 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 89.34 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 89.32 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 88.48 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 87.3 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 87.15 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 86.1 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 86.0 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 85.24 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 83.69 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 83.31 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 83.22 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 82.59 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 82.47 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 82.15 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 81.45 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 81.35 |
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.3e-37 Score=207.93 Aligned_cols=141 Identities=38% Similarity=0.614 Sum_probs=131.5
Q ss_pred hcCCCCceeEeecCceeeecCCCCHHHHHHHHHCCCcEEEEcCCCCcCCCcccCCCCeEEEeecCCCCCCCHHHHHHHHH
Q psy15044 11 EKEGPRNFSWIVPDELAAMACPDTRDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPVEEYHAPTMRQVIKFIE 90 (154)
Q Consensus 11 ~~~~~~~~~~i~~~~~~~~~~p~~~~~~~~l~~~gi~~Vv~l~~~~~~~~~~~~~~~~~~~~p~~d~~~p~~~~~~~~~~ 90 (154)
|+.||.|++||.||++|+|+.|.+.++++.|+++||++||||+.+. +.......|++|+++|+.|...|+.+.+.++++
T Consensus 1 m~~pp~~~~~i~~~~l~~~~~p~~~~~~~~L~~~gi~~Vi~l~~~~-~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~ 79 (150)
T 4erc_A 1 MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERG-PPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQ 79 (150)
T ss_dssp CCCCCTTCEEEETTTEEEESCCCSHHHHHHHHHTTEEEEEECSSSC-CTTGGGCTTSEEEECCCCTTSCCCHHHHHHHHH
T ss_pred CCCCCCCCEEeccCceeeecCCCCHHHHHHHHHCCCCEEEEcCCCC-CCcccccCCceEEEEecCCCCCCCHHHHHHHHH
Confidence 5789999999999999999999889999999999999999999997 555555679999999999999899888999999
Q ss_pred HHHHHHhCCCcEEEeCCCCCChHHHHHHHHHHHHcCCCHHHHHHHHHHhCCCCCCCcccccc
Q psy15044 91 FCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAITTLRLARPGSLECHFCNKE 152 (154)
Q Consensus 91 ~i~~~~~~~~~vlVHC~~G~~Rsg~~~a~~l~~~~g~~~~~a~~~~r~~Rp~~i~~~~q~k~ 152 (154)
+++....++++|+|||.+|+||||+++++|+|...|++.++|++.+|++||+++++..|++.
T Consensus 80 ~i~~~~~~~~~vlVHC~~G~~Rsg~~~a~~l~~~~~~~~~~a~~~vr~~R~~~~~~~~q~~~ 141 (150)
T 4erc_A 80 IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKA 141 (150)
T ss_dssp HHHHHHHTTCEEEEECSSSSHHHHHHHHHHHHHHHTCCHHHHHHHHHHHSTTCCCSHHHHHH
T ss_pred HHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHcCCCHHHHHHHHHHHCCCCCCCHHHHHH
Confidence 99999888899999999999999999999999989999999999999999999999999874
|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 154 | ||||
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 7e-28 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 1e-18 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 1e-14 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 3e-13 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 7e-13 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 1e-11 | |
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 9e-11 | |
| d1xria_ | 151 | c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal | 7e-10 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 1e-09 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 2e-08 | |
| d1ywfa1 | 272 | c.45.1.5 (A:4-275) Phosphotyrosine protein phospha | 4e-04 |
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Proline directed phosphatase CDC14b2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 99.7 bits (248), Expect = 7e-28
Identities = 33/143 (23%), Positives = 59/143 (41%), Gaps = 16/143 (11%)
Query: 17 NFSWIVPDELAAMACPDTR-------------DHLKTLSYRGVCHLVSLSEECIPDGIER 63
+ +WI+PD A P +R +++ V ++ L++
Sbjct: 17 DLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFT 76
Query: 64 YEPLNWILIPVEEYHAPTMRQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVY 123
+ + + PT V +F++ C A+ VH ++G GRTG + ACY++
Sbjct: 77 DAGFDHHDLFFADGSTPTDAIVKEFLDIC---ENAEGAIAVHSKAGLGRTGTLIACYIMK 133
Query: 124 FLGMTPERAITTLRLARPGSLEC 146
MT I +R+ RPGS+
Sbjct: 134 HYRMTAAETIAWVRICRPGSVIG 156
|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 272 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 154 | |||
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 100.0 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.97 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.97 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.96 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.96 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.95 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.93 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.92 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.92 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 99.67 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 99.67 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 99.66 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 99.66 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 99.64 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 99.63 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 99.63 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 99.63 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 99.61 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 99.61 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 99.6 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 99.55 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.48 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 97.74 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 96.78 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 95.82 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 94.43 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 92.54 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 90.96 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 90.07 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 89.78 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 87.83 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 87.78 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 85.4 |
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Proline directed phosphatase CDC14b2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=3.6e-33 Score=192.74 Aligned_cols=131 Identities=24% Similarity=0.460 Sum_probs=113.6
Q ss_pred CceeEeecCceeeecCCCC-------------HHHHHHHHHCCCcEEEEcCCCCcCCCcccCCCCeEEEeecCCCCCCCH
Q psy15044 16 RNFSWIVPDELAAMACPDT-------------RDHLKTLSYRGVCHLVSLSEECIPDGIERYEPLNWILIPVEEYHAPTM 82 (154)
Q Consensus 16 ~~~~~i~~~~~~~~~~p~~-------------~~~~~~l~~~gi~~Vv~l~~~~~~~~~~~~~~~~~~~~p~~d~~~p~~ 82 (154)
.+++||+|++|++++.|.. .+.++.|+++||++||||+.+.++.......|+.|+++|++|...|+.
T Consensus 16 gD~~wI~P~~~ia~s~P~~~~~~~~~~~~~~~~~~l~~l~~~gi~~Ii~l~~~~~~~~~~~~~gi~~~~~p~~D~~~P~~ 95 (182)
T d1ohea2 16 GDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTD 95 (182)
T ss_dssp TCEEEEETTTEEEECCCCSSCBCSTTCCBCCTHHHHHHHHHTTEEEEEECSCCSSCTHHHHTTTCEEEECCCCTTCCCCH
T ss_pred CCcceEccCCeEEEcCCCccccccccccccCHHHHHHHHHhcCCCEEEEecCCCcCccccccCCcEEEecCCCCCCCcCH
Confidence 4799999999999999943 245789999999999999987655555667799999999999999987
Q ss_pred HHHHHHHHHHHHHHhCCCcEEEeCCCCCChHHHHHHHHHHHHcCCCHHHHHHHHHHhCCCCCCCccc
Q psy15044 83 RQVIKFIEFCVNCRQKGEAVGVHCRSGRGRTGVMAACYLVYFLGMTPERAITTLRLARPGSLECHFC 149 (154)
Q Consensus 83 ~~~~~~~~~i~~~~~~~~~vlVHC~~G~~Rsg~~~a~~l~~~~g~~~~~a~~~~r~~Rp~~i~~~~q 149 (154)
+.+.++++. ..+.+++|+|||.+|+||||+++++|||...||++++|++++|++||+++.++.|
T Consensus 96 ~~i~~~i~~---~~~~~~~V~VHC~~G~gRsgt~~a~yL~~~~~~~~~~Al~~vr~~Rp~~i~~~qq 159 (182)
T d1ohea2 96 AIVKEFLDI---CENAEGAIAVHSKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQ 159 (182)
T ss_dssp HHHHHHHHH---HHSCSSEEEEECSSSSHHHHHHHHHHHHHHHCCCHHHHHHHHHHHSTTCSCTHHH
T ss_pred HHHHHHHHH---HHcCCCcEEEEeCCCCcchHHHHHHHHHHHcCCCHHHHHHHHHHHCCCCccCHHH
Confidence 766555544 4467789999999999999999999999999999999999999999999999766
|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|