Diaphorina citri psyllid: psy15047


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MDTEKYYHTHYPWDHNEKMDKHWASLRPATEERYSSKPTDTWNANGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEKSVSSRGTSVTSSVSSRGSGKISLSSCSSDQDGQEEGFVTSY
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*****YY**************************************************LFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIH********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTEKYYHTHYPWDHNEKMDKHWASLRPATEERYSSKPTDTWNANGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEKSVSSRGTSVTSSVSSRGSGKISLSSCSSDQDGQEEGFVTSY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 14 confidentQ9C9N3
Zinc finger protein 36, C3H1 type-like 1 Probable regulatory protein involved in regulating the response to growth factors.confidentP23950

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043186 [CC]P granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 55-92
View the alignment between query and template
View the model in PyMOL
Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 34-55
View the alignment between query and template
View the model in PyMOL