Psyllid ID: psy15047


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MDTEKYYHTHYPWDHNEKMDKHWASLRPATEERYSSKPTDTWNANGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEKSVSSRGTSVTSSVSSRGSGKISLSSCSSDQDGQEEGFVTSY
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccHcccccccccccccHcccccccccccccccccccccccccccccccccccccccccccHccccHHccccccccccccEcccHHHcccccccccccccHHcHEEEcccccccccEEEEcccccccccccccccccccccccccccccccccccccccccEEcc
mdtekyyhthypwdhnekmdkhwaslrpateerysskptdtwnangryshfyhsrenlFKTELcrlhdetgvckfgtgckfahgahelrviprhpryrtklcqsyhqdgfcpygqrcyfiheeksvssrgtsvtssvssrgsgkislsscssdqdgqeegfvtsy
mdtekyyhthypwdhnekmDKHWASLRPATeerysskptdtwnaNGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEksvssrgtsvtssvssrgsgkislsscssdqdgqeegfvtsy
MDTEKYYHTHYPWDHNEKMDKHWASLRPATEERYSSKPTDTWNANGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEksvssrgtsvtssvssrgsgkislsscssDQDGQEEGFVTSY
*****YYHTHYPWDH*************************TWNANGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIH********************************************
*****YY******************************************************ELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFI*********************************************
MDTEKYYHTHYPWDHNEKMDKHWASLRPATEERYSSKPTDTWNANGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEK*****************************************
*********************************************************LFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEE************************************G*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTEKYYHTHYPWDHNEKMDKHWASLRPATEERYSSKPTDTWNANGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEKSVSSRGTSVTSSVSSRGSGKISLSSCSSDQDGQEEGFVTSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query165 2.2.26 [Sep-21-2011]
Q7ZXW9 363 Zinc finger protein 36, C N/A N/A 0.351 0.159 0.619 8e-21
P17431 338 Zinc finger protein 36, C no N/A 0.466 0.227 0.531 9e-21
P23950 338 Zinc finger protein 36, C yes N/A 0.466 0.227 0.531 9e-21
Q805B4 364 Zinc finger protein 36, C N/A N/A 0.351 0.159 0.619 1e-20
Q07352 338 Zinc finger protein 36, C yes N/A 0.333 0.162 0.590 1e-20
P47974 494 Zinc finger protein 36, C no N/A 0.448 0.149 0.558 2e-20
P23949 367 Zinc finger protein 36, C no N/A 0.351 0.158 0.619 4e-20
A4IIN5 333 Zinc finger protein 36, C no N/A 0.351 0.174 0.603 5e-20
P47980 436 Protein TIS11 OS=Drosophi yes N/A 0.351 0.133 0.587 3e-19
P53781 324 Tristetraprolin OS=Bos ta no N/A 0.509 0.259 0.420 8e-17
>sp|Q7ZXW9|TISDA_XENLA Zinc finger protein 36, C3H1 type-like 2-A OS=Xenopus laevis GN=zfp36l2-A PE=2 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 39/63 (61%), Positives = 52/63 (82%)

Query: 59  FKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCY 118
           +KTELCR  +E+G CK+G  C+FAHG HELR + RHP+Y+T+LC+++H  GFCPYG RC+
Sbjct: 132 YKTELCRPFEESGACKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCH 191

Query: 119 FIH 121
           FIH
Sbjct: 192 FIH 194




Required for tubulogenesis during pronephros development.
Xenopus laevis (taxid: 8355)
>sp|P17431|TISB_RAT Zinc finger protein 36, C3H1 type-like 1 OS=Rattus norvegicus GN=Zfp36l1 PE=1 SV=1 Back     alignment and function description
>sp|P23950|TISB_MOUSE Zinc finger protein 36, C3H1 type-like 1 OS=Mus musculus GN=Zfp36l1 PE=1 SV=1 Back     alignment and function description
>sp|Q805B4|TISDB_XENLA Zinc finger protein 36, C3H1 type-like 2-B OS=Xenopus laevis GN=zfp36l2-B PE=2 SV=1 Back     alignment and function description
>sp|Q07352|TISB_HUMAN Zinc finger protein 36, C3H1 type-like 1 OS=Homo sapiens GN=ZFP36L1 PE=1 SV=1 Back     alignment and function description
>sp|P47974|TISD_HUMAN Zinc finger protein 36, C3H1 type-like 2 OS=Homo sapiens GN=ZFP36L2 PE=1 SV=3 Back     alignment and function description
>sp|P23949|TISD_MOUSE Zinc finger protein 36, C3H1 type-like 2 OS=Mus musculus GN=Zfp36l2 PE=2 SV=1 Back     alignment and function description
>sp|A4IIN5|TISD_XENTR Zinc finger protein 36, C3H1 type-like 2 OS=Xenopus tropicalis GN=zfp36l2 PE=2 SV=1 Back     alignment and function description
>sp|P47980|TIS1_DROME Protein TIS11 OS=Drosophila melanogaster GN=Tis11 PE=2 SV=2 Back     alignment and function description
>sp|P53781|TTP_BOVIN Tristetraprolin OS=Bos taurus GN=ZFP36 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
72010393 386 PREDICTED: zinc finger protein 36, C3H1 0.606 0.259 0.475 6e-22
427781319 368 hypothetical protein [Rhipicephalus pulc 0.612 0.274 0.445 4e-21
300708890 309 hypothetical protein NCER_100276 [Nosema 0.606 0.323 0.445 2e-20
449688559 332 PREDICTED: zinc finger protein 36, C3H1 0.781 0.388 0.425 2e-20
307947822 503 Tis11-like protein [Ilyanassa obsoleta] 0.393 0.129 0.646 3e-20
449015411 647 unknown zinc finger protein [Cyanidiosch 0.424 0.108 0.571 3e-20
118344116 380 zinc finger protein [Ciona intestinalis] 0.684 0.297 0.418 3e-20
2353340 401 Tis11 family protein [Crassostrea virgin 0.563 0.231 0.473 3e-20
118404606 345 ZFP36 ring finger protein-like 1 [Xenopu 0.503 0.240 0.515 3e-20
312383024 572 hypothetical protein AND_04029 [Anophele 0.424 0.122 0.533 5e-20
>gi|72010393|ref|XP_782811.1| PREDICTED: zinc finger protein 36, C3H1 type-like 2-A-like isoform 2 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 73/103 (70%), Gaps = 3/103 (2%)

Query: 31  EERYSSKPTD-TWNANGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELR 89
           +E  ++KP D   + + R +   +   + +KTELCR ++E G CK+G  C+FAHG HELR
Sbjct: 89  KENLNNKPRDRALSESDRNNQTRNQNSSRYKTELCRPYEENGTCKYGDKCQFAHGIHELR 148

Query: 90  VIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIH--EEKSVSSRG 130
           V+ RHP+Y+T+LC+++H  GFCPYG RC+FIH  +E+ +SS G
Sbjct: 149 VLSRHPKYKTELCRTFHTVGFCPYGPRCHFIHNPDERKLSSPG 191




Source: Strongylocentrotus purpuratus

Species: Strongylocentrotus purpuratus

Genus: Strongylocentrotus

Family: Strongylocentrotidae

Order: Echinoida

Class: Echinoidea

Phylum: Echinodermata

Superkingdom: Eukaryota

>gi|427781319|gb|JAA56111.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|300708890|ref|XP_002996616.1| hypothetical protein NCER_100276 [Nosema ceranae BRL01] gi|239605931|gb|EEQ82945.1| hypothetical protein NCER_100276 [Nosema ceranae BRL01] Back     alignment and taxonomy information
>gi|449688559|ref|XP_002159721.2| PREDICTED: zinc finger protein 36, C3H1 type-like 1-like [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|307947822|gb|ABV54790.2| Tis11-like protein [Ilyanassa obsoleta] Back     alignment and taxonomy information
>gi|449015411|dbj|BAM78813.1| unknown zinc finger protein [Cyanidioschyzon merolae strain 10D] Back     alignment and taxonomy information
>gi|118344116|ref|NP_001071879.1| zinc finger protein [Ciona intestinalis] gi|70571730|dbj|BAE06810.1| zinc finger protein [Ciona intestinalis] Back     alignment and taxonomy information
>gi|2353340|gb|AAB69448.1| Tis11 family protein [Crassostrea virginica] Back     alignment and taxonomy information
>gi|118404606|ref|NP_001072758.1| ZFP36 ring finger protein-like 1 [Xenopus (Silurana) tropicalis] gi|116487406|gb|AAI25787.1| hypothetical protein MGC147385 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|312383024|gb|EFR28263.1| hypothetical protein AND_04029 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
UNIPROTKB|Q7ZXW9 363 zfp36l2-A "Zinc finger protein 0.381 0.173 0.619 1.5e-21
UNIPROTKB|A7MB98 338 ZFP36L1 "Uncharacterized prote 0.381 0.186 0.619 1.5e-21
UNIPROTKB|E2R2W0 338 ZFP36L1 "Uncharacterized prote 0.381 0.186 0.619 1.5e-21
UNIPROTKB|G3V2D5176 ZFP36L1 "Zinc finger protein 3 0.381 0.357 0.619 1.5e-21
UNIPROTKB|G3V2P5207 ZFP36L1 "Zinc finger protein 3 0.381 0.304 0.619 1.5e-21
UNIPROTKB|Q07352 338 ZFP36L1 "Zinc finger protein 3 0.381 0.186 0.619 1.5e-21
UNIPROTKB|I3LB77 338 ZFP36L1 "Uncharacterized prote 0.381 0.186 0.619 1.5e-21
MGI|MGI:107946 338 Zfp36l1 "zinc finger protein 3 0.381 0.186 0.619 1.5e-21
MGI|MGI:107945 367 Zfp36l2 "zinc finger protein 3 0.381 0.171 0.619 1.5e-21
RGD|62009 338 Zfp36l1 "zinc finger protein 3 0.381 0.186 0.619 1.5e-21
UNIPROTKB|Q7ZXW9 zfp36l2-A "Zinc finger protein 36, C3H1 type-like 2-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 252 (93.8 bits), Expect = 1.5e-21, P = 1.5e-21
 Identities = 39/63 (61%), Positives = 52/63 (82%)

Query:    59 FKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCY 118
             +KTELCR  +E+G CK+G  C+FAHG HELR + RHP+Y+T+LC+++H  GFCPYG RC+
Sbjct:   132 YKTELCRPFEESGACKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCH 191

Query:   119 FIH 121
             FIH
Sbjct:   192 FIH 194


GO:0000288 "nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS
GO:0043488 "regulation of mRNA stability" evidence=ISS
GO:0048793 "pronephros development" evidence=ISS
UNIPROTKB|A7MB98 ZFP36L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2W0 ZFP36L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3V2D5 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V2P5 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q07352 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LB77 ZFP36L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:107946 Zfp36l1 "zinc finger protein 36, C3H type-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:107945 Zfp36l2 "zinc finger protein 36, C3H type-like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|62009 Zfp36l1 "zinc finger protein 36, C3H type-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P23950TISB_MOUSENo assigned EC number0.53160.46660.2278yesN/A
Q9C9N3C3H14_ARATHNo assigned EC number0.50740.40600.2161yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
COG5063 351 COG5063, CTH1, CCCH-type Zn-finger protein [Genera 3e-11
COG5063351 COG5063, CTH1, CCCH-type Zn-finger protein [Genera 3e-07
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 3e-05
COG5063351 COG5063, CTH1, CCCH-type Zn-finger protein [Genera 2e-04
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 3e-04
>gnl|CDD|227395 COG5063, CTH1, CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
 Score = 60.1 bits (145), Expect = 3e-11
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 46  GRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSY 105
            R S+       L+KTE+ R   E   C++     FAH      +   HP+Y+T+  + +
Sbjct: 101 PRGSNANK-PYGLYKTEMLRSSTEIPYCRYPDKNPFAHSKAISSLAQTHPKYKTESLEVF 159

Query: 106 HQDGFCPYGQRCYFIH 121
              G+ PY +RC FI 
Sbjct: 160 INPGYVPYSKRCCFIS 175


Length = 351

>gnl|CDD|227395 COG5063, CTH1, CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information
>gnl|CDD|227395 COG5063, CTH1, CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 165
KOG1677|consensus332 99.68
KOG1595|consensus 528 99.29
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 99.27
KOG1677|consensus332 98.97
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 98.94
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 98.78
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 98.6
KOG1040|consensus 325 98.47
smart0035627 ZnF_C3H1 zinc finger. 98.29
KOG2333|consensus 614 98.18
KOG2494|consensus 331 98.04
KOG1040|consensus 325 98.02
smart0035627 ZnF_C3H1 zinc finger. 98.02
KOG1763|consensus 343 97.93
KOG1595|consensus 528 97.64
COG5252299 Uncharacterized conserved protein, contains CCCH-t 97.56
KOG1492|consensus377 97.53
KOG1492|consensus377 97.46
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 97.29
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 97.28
KOG2185|consensus 486 96.86
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 96.19
KOG2185|consensus 486 96.11
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 95.85
COG5152259 Uncharacterized conserved protein, contains RING a 95.53
COG5152259 Uncharacterized conserved protein, contains RING a 94.47
KOG2333|consensus 614 94.44
KOG2494|consensus 331 92.58
KOG2202|consensus260 92.12
KOG1813|consensus313 91.84
KOG4791|consensus 667 91.62
KOG1039|consensus 344 91.07
KOG1039|consensus 344 90.33
KOG3702|consensus681 89.5
KOG1813|consensus313 88.97
KOG4791|consensus 667 88.88
KOG1763|consensus 343 88.08
PF1065023 zf-C3H1: Putative zinc-finger domain; InterPro: IP 82.97
KOG3702|consensus681 81.87
>KOG1677|consensus Back     alignment and domain information
Probab=99.68  E-value=3.7e-17  Score=139.50  Aligned_cols=96  Identities=39%  Similarity=0.843  Sum_probs=81.2

Q ss_pred             cCCCCCCCCCCCCCCCCCC-------------CcCccCCccccccccccCCCCCC-CCCCccccCCcccc------cccC
Q psy15047         34 YSSKPTDTWNANGRYSHFY-------------HSRENLFKTELCRLHDETGVCKF-GTGCKFAHGAHELR------VIPR   93 (165)
Q Consensus        34 ~~~~~~c~~~~~~~~~h~~-------------~~~~~~~KT~lC~~y~~~G~C~~-Gd~C~FaH~~~elr------~~~~   93 (165)
                      +...+.|.++..|.+.|..             ......+||.+|.+|...|.|+| |++|+|+|+.++++      ....
T Consensus        92 ~~~~~~~~~~s~~~~~~p~~~~~~~~~~~~~~~~~p~~~kt~lc~~~~~~g~c~y~ge~crfah~~~e~r~~~~~~~~~~  171 (332)
T KOG1677|consen   92 YLRTGVCGYGSSCRYNHPDLRLRPRPVRRSRGERKPERYKTPLCRSFRKSGTCKYRGEQCRFAHGLEELRLPSSENQVGN  171 (332)
T ss_pred             ccccCCCCCCCCCCccCcccccccCCccccccccCcccccCCcceeeecCccccccCchhhhcCCcccccccccchhhcC
Confidence            4556677777777776664             23456799999999999999999 99999999999999      4456


Q ss_pred             CCCccccccccccccccCCCCCCCccCCCCCCCCCC
Q psy15047         94 HPRYRTKLCQSYHQDGFCPYGQRCYFIHEEKSVSSR  129 (165)
Q Consensus        94 ~~~~kt~~C~~f~~~G~C~~G~~C~F~H~~~~~~~~  129 (165)
                      +++|+|++|..|+++|.|+||.+|+|+|+..+....
T Consensus       172 ~~~~kt~lC~~f~~tG~C~yG~rC~F~H~~~~~~~~  207 (332)
T KOG1677|consen  172 PPKYKTKLCPKFQKTGLCKYGSRCRFIHGEPEDRAS  207 (332)
T ss_pred             CCCCCCcCCCccccCCCCCCCCcCeecCCCcccccc
Confidence            789999999999999999999999999998866554



>KOG1595|consensus Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1677|consensus Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1040|consensus Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG2333|consensus Back     alignment and domain information
>KOG2494|consensus Back     alignment and domain information
>KOG1040|consensus Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG1763|consensus Back     alignment and domain information
>KOG1595|consensus Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1492|consensus Back     alignment and domain information
>KOG1492|consensus Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG2185|consensus Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG2185|consensus Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2333|consensus Back     alignment and domain information
>KOG2494|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG4791|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG3702|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG4791|consensus Back     alignment and domain information
>KOG1763|consensus Back     alignment and domain information
>PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger Back     alignment and domain information
>KOG3702|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
1rgo_A70 Structural Basis For Recognition Of The Mrna Class 1e-19
1m9o_A77 Nmr Structure Of The First Zinc Binding Domain Of N 2e-16
>pdb|1RGO|A Chain A, Structural Basis For Recognition Of The Mrna Class Ii Au- Rich Element By The Tandem Zinc Finger Domain Of Tis11d Length = 70 Back     alignment and structure

Iteration: 1

Score = 92.0 bits (227), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 39/63 (61%), Positives = 52/63 (82%) Query: 59 FKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCY 118 +KTELCR +E+G CK+G C+FAHG HELR + RHP+Y+T+LC+++H GFCPYG RC+ Sbjct: 4 YKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCH 63 Query: 119 FIH 121 FIH Sbjct: 64 FIH 66
>pdb|1M9O|A Chain A, Nmr Structure Of The First Zinc Binding Domain Of Nup475TTPTIS11 Length = 77 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 2e-20
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 1e-05
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 2e-05
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 2e-07
2rhk_C72 Cleavage and polyadenylation specificity factor su 2e-04
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
 Score = 79.2 bits (195), Expect = 2e-20
 Identities = 35/70 (50%), Positives = 48/70 (68%)

Query: 54  SRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPY 113
           +  + +KTELCR + E+G C++G  C+FAHG  ELR   RHP+Y+T+LC  +   G CPY
Sbjct: 5   TTSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFKLQGRCPY 64

Query: 114 GQRCYFIHEE 123
           G RC+FIH  
Sbjct: 65  GSRCHFIHNP 74


>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.81
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 99.51
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 99.46
2rhk_C72 Cleavage and polyadenylation specificity factor su 99.37
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 99.23
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.12
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 99.07
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 98.92
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 98.74
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 98.72
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 98.66
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 98.58
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 98.27
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 98.18
2rhk_C72 Cleavage and polyadenylation specificity factor su 98.13
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 97.68
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 97.27
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 97.11
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 97.07
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 96.73
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 96.71
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 96.5
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 94.79
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 93.53
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 92.12
3u1l_A 240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 89.8
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
Probab=99.81  E-value=5.4e-21  Score=130.84  Aligned_cols=71  Identities=49%  Similarity=1.091  Sum_probs=34.7

Q ss_pred             CccCCccccccccccCCCCCCCCCCccccCCcccccccCCCCccccccccccccccCCCCCCCccCCCCCC
Q psy15047         55 RENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEKS  125 (165)
Q Consensus        55 ~~~~~KT~lC~~y~~~G~C~~Gd~C~FaH~~~elr~~~~~~~~kt~~C~~f~~~G~C~~G~~C~F~H~~~~  125 (165)
                      .+.++||+||++|+..|.|++|++|+|+|+..+++....++.+++.+|++|...|.|++|.+|+|+|+..+
T Consensus         6 ~~~~~kt~~C~~f~~~G~C~~G~~C~f~H~~~e~~~~~~~~~~k~~~C~~f~~~G~C~~G~~C~f~H~~~e   76 (77)
T 1m9o_A            6 TSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFKLQGRCPYGSRCHFIHNPTE   76 (77)
T ss_dssp             CSSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCCGGGTC---------------------------------
T ss_pred             CCCCccchhCHHhhhCCCcCCCCCccCCCCChhhccccccccccCCcccchhhCcCCCCcCcCCCCCCCCC
Confidence            35689999999998789999999999999999999877777899999999988999999999999998764



>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 165
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 9e-11
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 1e-07
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 1e-09
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 5e-07
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 2e-09
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 3e-07
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure

class: Small proteins
fold: CCCH zinc finger
superfamily: CCCH zinc finger
family: CCCH zinc finger
domain: Butyrate response factor 2 (Tis11D)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.0 bits (125), Expect = 9e-11
 Identities = 19/32 (59%), Positives = 26/32 (81%)

Query: 93  RHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEK 124
           RHP+Y+T+LC+++H  GFCPYG RC+FIH   
Sbjct: 2   RHPKYKTELCRTFHTIGFCPYGPRCHFIHNAD 33


>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 99.37
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.36
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.29
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 99.15
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.14
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.03
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 98.11
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 97.55
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 97.3
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 96.83
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 96.22
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 91.04
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: CCCH zinc finger
superfamily: CCCH zinc finger
family: CCCH zinc finger
domain: Tristetraproline (ttp, tis11, nup475)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.37  E-value=1.4e-13  Score=82.34  Aligned_cols=36  Identities=50%  Similarity=0.999  Sum_probs=32.0

Q ss_pred             ccCCccccccccccCCCCCCCCCCccccCCcccccc
Q psy15047         56 ENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVI   91 (165)
Q Consensus        56 ~~~~KT~lC~~y~~~G~C~~Gd~C~FaH~~~elr~~   91 (165)
                      +.+|||+||++|...|.|++|++|.|||+.+|||.+
T Consensus         4 ~~~yKT~lC~~~~~~g~C~~G~~C~FAHg~~ELr~~   39 (40)
T d1m9oa_           4 SSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQA   39 (40)
T ss_dssp             SSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCCGGGT
T ss_pred             CCccccccChhhhcCCcCCCCCCCCCCCCHHHhcCC
Confidence            568999999999888999999999999999999864



>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure