Psyllid ID: psy15047
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 165 | ||||||
| 72010393 | 386 | PREDICTED: zinc finger protein 36, C3H1 | 0.606 | 0.259 | 0.475 | 6e-22 | |
| 427781319 | 368 | hypothetical protein [Rhipicephalus pulc | 0.612 | 0.274 | 0.445 | 4e-21 | |
| 300708890 | 309 | hypothetical protein NCER_100276 [Nosema | 0.606 | 0.323 | 0.445 | 2e-20 | |
| 449688559 | 332 | PREDICTED: zinc finger protein 36, C3H1 | 0.781 | 0.388 | 0.425 | 2e-20 | |
| 307947822 | 503 | Tis11-like protein [Ilyanassa obsoleta] | 0.393 | 0.129 | 0.646 | 3e-20 | |
| 449015411 | 647 | unknown zinc finger protein [Cyanidiosch | 0.424 | 0.108 | 0.571 | 3e-20 | |
| 118344116 | 380 | zinc finger protein [Ciona intestinalis] | 0.684 | 0.297 | 0.418 | 3e-20 | |
| 2353340 | 401 | Tis11 family protein [Crassostrea virgin | 0.563 | 0.231 | 0.473 | 3e-20 | |
| 118404606 | 345 | ZFP36 ring finger protein-like 1 [Xenopu | 0.503 | 0.240 | 0.515 | 3e-20 | |
| 312383024 | 572 | hypothetical protein AND_04029 [Anophele | 0.424 | 0.122 | 0.533 | 5e-20 |
| >gi|72010393|ref|XP_782811.1| PREDICTED: zinc finger protein 36, C3H1 type-like 2-A-like isoform 2 [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
Score = 108 bits (271), Expect = 6e-22, Method: Compositional matrix adjust.
Identities = 49/103 (47%), Positives = 73/103 (70%), Gaps = 3/103 (2%)
Query: 31 EERYSSKPTD-TWNANGRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELR 89
+E ++KP D + + R + + + +KTELCR ++E G CK+G C+FAHG HELR
Sbjct: 89 KENLNNKPRDRALSESDRNNQTRNQNSSRYKTELCRPYEENGTCKYGDKCQFAHGIHELR 148
Query: 90 VIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIH--EEKSVSSRG 130
V+ RHP+Y+T+LC+++H GFCPYG RC+FIH +E+ +SS G
Sbjct: 149 VLSRHPKYKTELCRTFHTVGFCPYGPRCHFIHNPDERKLSSPG 191
|
Source: Strongylocentrotus purpuratus Species: Strongylocentrotus purpuratus Genus: Strongylocentrotus Family: Strongylocentrotidae Order: Echinoida Class: Echinoidea Phylum: Echinodermata Superkingdom: Eukaryota |
| >gi|427781319|gb|JAA56111.1| hypothetical protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|300708890|ref|XP_002996616.1| hypothetical protein NCER_100276 [Nosema ceranae BRL01] gi|239605931|gb|EEQ82945.1| hypothetical protein NCER_100276 [Nosema ceranae BRL01] | Back alignment and taxonomy information |
|---|
| >gi|449688559|ref|XP_002159721.2| PREDICTED: zinc finger protein 36, C3H1 type-like 1-like [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|307947822|gb|ABV54790.2| Tis11-like protein [Ilyanassa obsoleta] | Back alignment and taxonomy information |
|---|
| >gi|449015411|dbj|BAM78813.1| unknown zinc finger protein [Cyanidioschyzon merolae strain 10D] | Back alignment and taxonomy information |
|---|
| >gi|118344116|ref|NP_001071879.1| zinc finger protein [Ciona intestinalis] gi|70571730|dbj|BAE06810.1| zinc finger protein [Ciona intestinalis] | Back alignment and taxonomy information |
|---|
| >gi|2353340|gb|AAB69448.1| Tis11 family protein [Crassostrea virginica] | Back alignment and taxonomy information |
|---|
| >gi|118404606|ref|NP_001072758.1| ZFP36 ring finger protein-like 1 [Xenopus (Silurana) tropicalis] gi|116487406|gb|AAI25787.1| hypothetical protein MGC147385 [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|312383024|gb|EFR28263.1| hypothetical protein AND_04029 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 165 | ||||||
| UNIPROTKB|Q7ZXW9 | 363 | zfp36l2-A "Zinc finger protein | 0.381 | 0.173 | 0.619 | 1.5e-21 | |
| UNIPROTKB|A7MB98 | 338 | ZFP36L1 "Uncharacterized prote | 0.381 | 0.186 | 0.619 | 1.5e-21 | |
| UNIPROTKB|E2R2W0 | 338 | ZFP36L1 "Uncharacterized prote | 0.381 | 0.186 | 0.619 | 1.5e-21 | |
| UNIPROTKB|G3V2D5 | 176 | ZFP36L1 "Zinc finger protein 3 | 0.381 | 0.357 | 0.619 | 1.5e-21 | |
| UNIPROTKB|G3V2P5 | 207 | ZFP36L1 "Zinc finger protein 3 | 0.381 | 0.304 | 0.619 | 1.5e-21 | |
| UNIPROTKB|Q07352 | 338 | ZFP36L1 "Zinc finger protein 3 | 0.381 | 0.186 | 0.619 | 1.5e-21 | |
| UNIPROTKB|I3LB77 | 338 | ZFP36L1 "Uncharacterized prote | 0.381 | 0.186 | 0.619 | 1.5e-21 | |
| MGI|MGI:107946 | 338 | Zfp36l1 "zinc finger protein 3 | 0.381 | 0.186 | 0.619 | 1.5e-21 | |
| MGI|MGI:107945 | 367 | Zfp36l2 "zinc finger protein 3 | 0.381 | 0.171 | 0.619 | 1.5e-21 | |
| RGD|62009 | 338 | Zfp36l1 "zinc finger protein 3 | 0.381 | 0.186 | 0.619 | 1.5e-21 |
| UNIPROTKB|Q7ZXW9 zfp36l2-A "Zinc finger protein 36, C3H1 type-like 2-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Score = 252 (93.8 bits), Expect = 1.5e-21, P = 1.5e-21
Identities = 39/63 (61%), Positives = 52/63 (82%)
Query: 59 FKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCY 118
+KTELCR +E+G CK+G C+FAHG HELR + RHP+Y+T+LC+++H GFCPYG RC+
Sbjct: 132 YKTELCRPFEESGACKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCH 191
Query: 119 FIH 121
FIH
Sbjct: 192 FIH 194
|
|
| UNIPROTKB|A7MB98 ZFP36L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R2W0 ZFP36L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V2D5 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V2P5 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q07352 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LB77 ZFP36L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107946 Zfp36l1 "zinc finger protein 36, C3H type-like 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107945 Zfp36l2 "zinc finger protein 36, C3H type-like 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|62009 Zfp36l1 "zinc finger protein 36, C3H type-like 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| COG5063 | 351 | COG5063, CTH1, CCCH-type Zn-finger protein [Genera | 3e-11 | |
| COG5063 | 351 | COG5063, CTH1, CCCH-type Zn-finger protein [Genera | 3e-07 | |
| pfam00642 | 27 | pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t | 3e-05 | |
| COG5063 | 351 | COG5063, CTH1, CCCH-type Zn-finger protein [Genera | 2e-04 | |
| pfam00642 | 27 | pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t | 3e-04 |
| >gnl|CDD|227395 COG5063, CTH1, CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Score = 60.1 bits (145), Expect = 3e-11
Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
Query: 46 GRYSHFYHSRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSY 105
R S+ L+KTE+ R E C++ FAH + HP+Y+T+ + +
Sbjct: 101 PRGSNANK-PYGLYKTEMLRSSTEIPYCRYPDKNPFAHSKAISSLAQTHPKYKTESLEVF 159
Query: 106 HQDGFCPYGQRCYFIH 121
G+ PY +RC FI
Sbjct: 160 INPGYVPYSKRCCFIS 175
|
Length = 351 |
| >gnl|CDD|227395 COG5063, CTH1, CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) | Back alignment and domain information |
|---|
| >gnl|CDD|227395 COG5063, CTH1, CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| KOG1677|consensus | 332 | 99.68 | ||
| KOG1595|consensus | 528 | 99.29 | ||
| COG5063 | 351 | CTH1 CCCH-type Zn-finger protein [General function | 99.27 | |
| KOG1677|consensus | 332 | 98.97 | ||
| COG5063 | 351 | CTH1 CCCH-type Zn-finger protein [General function | 98.94 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 98.78 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 98.6 | |
| KOG1040|consensus | 325 | 98.47 | ||
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 98.29 | |
| KOG2333|consensus | 614 | 98.18 | ||
| KOG2494|consensus | 331 | 98.04 | ||
| KOG1040|consensus | 325 | 98.02 | ||
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 98.02 | |
| KOG1763|consensus | 343 | 97.93 | ||
| KOG1595|consensus | 528 | 97.64 | ||
| COG5252 | 299 | Uncharacterized conserved protein, contains CCCH-t | 97.56 | |
| KOG1492|consensus | 377 | 97.53 | ||
| KOG1492|consensus | 377 | 97.46 | ||
| COG5084 | 285 | YTH1 Cleavage and polyadenylation specificity fact | 97.29 | |
| COG5084 | 285 | YTH1 Cleavage and polyadenylation specificity fact | 97.28 | |
| KOG2185|consensus | 486 | 96.86 | ||
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 96.19 | |
| KOG2185|consensus | 486 | 96.11 | ||
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 95.85 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.53 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 94.47 | |
| KOG2333|consensus | 614 | 94.44 | ||
| KOG2494|consensus | 331 | 92.58 | ||
| KOG2202|consensus | 260 | 92.12 | ||
| KOG1813|consensus | 313 | 91.84 | ||
| KOG4791|consensus | 667 | 91.62 | ||
| KOG1039|consensus | 344 | 91.07 | ||
| KOG1039|consensus | 344 | 90.33 | ||
| KOG3702|consensus | 681 | 89.5 | ||
| KOG1813|consensus | 313 | 88.97 | ||
| KOG4791|consensus | 667 | 88.88 | ||
| KOG1763|consensus | 343 | 88.08 | ||
| PF10650 | 23 | zf-C3H1: Putative zinc-finger domain; InterPro: IP | 82.97 | |
| KOG3702|consensus | 681 | 81.87 |
| >KOG1677|consensus | Back alignment and domain information |
|---|
Probab=99.68 E-value=3.7e-17 Score=139.50 Aligned_cols=96 Identities=39% Similarity=0.843 Sum_probs=81.2
Q ss_pred cCCCCCCCCCCCCCCCCCC-------------CcCccCCccccccccccCCCCCC-CCCCccccCCcccc------cccC
Q psy15047 34 YSSKPTDTWNANGRYSHFY-------------HSRENLFKTELCRLHDETGVCKF-GTGCKFAHGAHELR------VIPR 93 (165)
Q Consensus 34 ~~~~~~c~~~~~~~~~h~~-------------~~~~~~~KT~lC~~y~~~G~C~~-Gd~C~FaH~~~elr------~~~~ 93 (165)
+...+.|.++..|.+.|.. ......+||.+|.+|...|.|+| |++|+|+|+.++++ ....
T Consensus 92 ~~~~~~~~~~s~~~~~~p~~~~~~~~~~~~~~~~~p~~~kt~lc~~~~~~g~c~y~ge~crfah~~~e~r~~~~~~~~~~ 171 (332)
T KOG1677|consen 92 YLRTGVCGYGSSCRYNHPDLRLRPRPVRRSRGERKPERYKTPLCRSFRKSGTCKYRGEQCRFAHGLEELRLPSSENQVGN 171 (332)
T ss_pred ccccCCCCCCCCCCccCcccccccCCccccccccCcccccCCcceeeecCccccccCchhhhcCCcccccccccchhhcC
Confidence 4556677777777776664 23456799999999999999999 99999999999999 4456
Q ss_pred CCCccccccccccccccCCCCCCCccCCCCCCCCCC
Q psy15047 94 HPRYRTKLCQSYHQDGFCPYGQRCYFIHEEKSVSSR 129 (165)
Q Consensus 94 ~~~~kt~~C~~f~~~G~C~~G~~C~F~H~~~~~~~~ 129 (165)
+++|+|++|..|+++|.|+||.+|+|+|+..+....
T Consensus 172 ~~~~kt~lC~~f~~tG~C~yG~rC~F~H~~~~~~~~ 207 (332)
T KOG1677|consen 172 PPKYKTKLCPKFQKTGLCKYGSRCRFIHGEPEDRAS 207 (332)
T ss_pred CCCCCCcCCCccccCCCCCCCCcCeecCCCcccccc
Confidence 789999999999999999999999999998866554
|
|
| >KOG1595|consensus | Back alignment and domain information |
|---|
| >COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1677|consensus | Back alignment and domain information |
|---|
| >COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1040|consensus | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >KOG2333|consensus | Back alignment and domain information |
|---|
| >KOG2494|consensus | Back alignment and domain information |
|---|
| >KOG1040|consensus | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >KOG1763|consensus | Back alignment and domain information |
|---|
| >KOG1595|consensus | Back alignment and domain information |
|---|
| >COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1492|consensus | Back alignment and domain information |
|---|
| >KOG1492|consensus | Back alignment and domain information |
|---|
| >COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2185|consensus | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >KOG2185|consensus | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2333|consensus | Back alignment and domain information |
|---|
| >KOG2494|consensus | Back alignment and domain information |
|---|
| >KOG2202|consensus | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >KOG4791|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG3702|consensus | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >KOG4791|consensus | Back alignment and domain information |
|---|
| >KOG1763|consensus | Back alignment and domain information |
|---|
| >PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger | Back alignment and domain information |
|---|
| >KOG3702|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 165 | ||||
| 1rgo_A | 70 | Structural Basis For Recognition Of The Mrna Class | 1e-19 | ||
| 1m9o_A | 77 | Nmr Structure Of The First Zinc Binding Domain Of N | 2e-16 |
| >pdb|1RGO|A Chain A, Structural Basis For Recognition Of The Mrna Class Ii Au- Rich Element By The Tandem Zinc Finger Domain Of Tis11d Length = 70 | Back alignment and structure |
|
| >pdb|1M9O|A Chain A, Nmr Structure Of The First Zinc Binding Domain Of Nup475TTPTIS11 Length = 77 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 2e-20 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 1e-05 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 2e-05 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 2e-07 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 2e-04 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 |
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
Score = 79.2 bits (195), Expect = 2e-20
Identities = 35/70 (50%), Positives = 48/70 (68%)
Query: 54 SRENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPY 113
+ + +KTELCR + E+G C++G C+FAHG ELR RHP+Y+T+LC + G CPY
Sbjct: 5 TTSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFKLQGRCPY 64
Query: 114 GQRCYFIHEE 123
G RC+FIH
Sbjct: 65 GSRCHFIHNP 74
|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 99.81 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 99.51 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 99.46 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 99.37 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 99.23 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 99.12 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 99.07 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 98.92 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 98.74 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 98.72 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 98.66 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 98.58 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 98.27 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 98.18 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 98.13 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 97.68 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 97.27 | |
| 3u9g_A | 229 | Zinc finger CCCH-type antiviral protein 1; zinc fi | 97.11 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 97.07 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 96.73 | |
| 3u9g_A | 229 | Zinc finger CCCH-type antiviral protein 1; zinc fi | 96.71 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 96.5 | |
| 2lhn_A | 80 | Nuclear polyadenylated RNA-binding protein NAB2; n | 94.79 | |
| 2lhn_A | 80 | Nuclear polyadenylated RNA-binding protein NAB2; n | 93.53 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 92.12 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 89.8 |
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
Probab=99.81 E-value=5.4e-21 Score=130.84 Aligned_cols=71 Identities=49% Similarity=1.091 Sum_probs=34.7
Q ss_pred CccCCccccccccccCCCCCCCCCCccccCCcccccccCCCCccccccccccccccCCCCCCCccCCCCCC
Q psy15047 55 RENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVIPRHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEKS 125 (165)
Q Consensus 55 ~~~~~KT~lC~~y~~~G~C~~Gd~C~FaH~~~elr~~~~~~~~kt~~C~~f~~~G~C~~G~~C~F~H~~~~ 125 (165)
.+.++||+||++|+..|.|++|++|+|+|+..+++....++.+++.+|++|...|.|++|.+|+|+|+..+
T Consensus 6 ~~~~~kt~~C~~f~~~G~C~~G~~C~f~H~~~e~~~~~~~~~~k~~~C~~f~~~G~C~~G~~C~f~H~~~e 76 (77)
T 1m9o_A 6 TSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFKLQGRCPYGSRCHFIHNPTE 76 (77)
T ss_dssp CSSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCCGGGTC---------------------------------
T ss_pred CCCCccchhCHHhhhCCCcCCCCCccCCCCChhhccccccccccCCcccchhhCcCCCCcCcCCCCCCCCC
Confidence 35689999999998789999999999999999999877777899999999988999999999999998764
|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
| >3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
| >3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 165 | ||||
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 9e-11 | |
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 1e-07 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 1e-09 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 5e-07 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 2e-09 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 3e-07 |
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
class: Small proteins fold: CCCH zinc finger superfamily: CCCH zinc finger family: CCCH zinc finger domain: Butyrate response factor 2 (Tis11D) species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.0 bits (125), Expect = 9e-11
Identities = 19/32 (59%), Positives = 26/32 (81%)
Query: 93 RHPRYRTKLCQSYHQDGFCPYGQRCYFIHEEK 124
RHP+Y+T+LC+++H GFCPYG RC+FIH
Sbjct: 2 RHPKYKTELCRTFHTIGFCPYGPRCHFIHNAD 33
|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 99.37 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.36 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.29 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 99.15 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.14 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.03 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 98.11 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 97.55 | |
| d2cqea1 | 56 | Zinc finger CCCH domain-containing protein C19orf7 | 97.3 | |
| d2cqea1 | 56 | Zinc finger CCCH domain-containing protein C19orf7 | 96.83 | |
| d2fc6a1 | 37 | Target of EGR1 protein 1, TOE1 {Human (Homo sapien | 96.22 | |
| d2fc6a1 | 37 | Target of EGR1 protein 1, TOE1 {Human (Homo sapien | 91.04 |
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: CCCH zinc finger superfamily: CCCH zinc finger family: CCCH zinc finger domain: Tristetraproline (ttp, tis11, nup475) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.37 E-value=1.4e-13 Score=82.34 Aligned_cols=36 Identities=50% Similarity=0.999 Sum_probs=32.0
Q ss_pred ccCCccccccccccCCCCCCCCCCccccCCcccccc
Q psy15047 56 ENLFKTELCRLHDETGVCKFGTGCKFAHGAHELRVI 91 (165)
Q Consensus 56 ~~~~KT~lC~~y~~~G~C~~Gd~C~FaH~~~elr~~ 91 (165)
+.+|||+||++|...|.|++|++|.|||+.+|||.+
T Consensus 4 ~~~yKT~lC~~~~~~g~C~~G~~C~FAHg~~ELr~~ 39 (40)
T d1m9oa_ 4 SSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQA 39 (40)
T ss_dssp SSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCCGGGT
T ss_pred CCccccccChhhhcCCcCCCCCCCCCCCCHHHhcCC
Confidence 568999999999888999999999999999999864
|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|