Diaphorina citri psyllid: psy15052

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--
MLIYIVGVRGHFLTSFLVSPGLKINPKPCSVNSVEGRCMFVWECINTDGHHLGMCVDTFMFGSCCSHNVTKNEISPLAQEKTSPTLLYTKPSTPHKTSPTVHKHTTSMKPTPTTTILYSKPYRQTPRPMLSYYSHKDISSKNTTQRPYVKPLKESLGRPVNVYSNNEKVDDFSTESVNSLLTSQIKIRVGEYDFSKLEEPYPYQERGVVKKMVHPKYNFFTYEYDLALVRLETPVEFAPNIVPICLPGSDDLLIGENATVTGWGRLSEGGSLPPVLQKVTVPIVSNEKCRSMFLRAGRYEFISDIFMCAGFDNGGRDSCQGDSGGPLQVKGKDGRYFLAGIISWGIGCAEANLPGVCTRISKFVPWVLDTGDSGGPLQVKGKDGRYFLAGIISWGIGCAEANLPGVCTRISKFVPWVLDTVT
cEEEEEcccccEEEccccccccccccccCCccccCEEEEEcHHHcccccCEEEEECccCEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEccccccCEEEccccEEEEEcccccccccccEEEEEccCCccccccccccEEEEEEEEEEccccccccccccEEEEEEcccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEECcHHHHHHHHHHccccccccccEEEEcccccccccccccccccEEECcccccEEEEEEEEEcccccccccccEEEEccccHHHHHHHccccccEEEccccccEEEccEEEcccccccccccccccccccccccEEcccc
MLIYIVGVRGHFLTSFLVSPGLKINPKPCSVNSVEGRCMFVWECINTDGHHLGMCVDTFMFGSCCSHNVTKNEISPL***************************************************************KNTTQRPYVKPLKESLGRPVNVYSNNEKVDDFSTESVNSLLTSQIKIRVGEYDFSKLEEPYPYQERGVVKKMVHPKYNFFTYEYDLALVRLETPVEFAPNIVPICLPGSDDLLIGENATVTGWGRLSEGGSLPPVLQKVTVPIVSNEKCRSMFLRAGRYEFISDIFMCAGFDNGGRDSCQGDSGGPLQVKGKDGRYFLAGIISWGIGCAEANLPGVCTRISKFVPWVLDTGDSGGPLQVKGKDGRYFLAGIISWGIGCAEANLPGVCTRISKFVPWVLDTVT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIYIVGVRGHFLTSFLVSPGLKINPKPCSVNSVEGRCMFVWECINTDGHHLGMCVDTFMFGSCCSHNVTKNEISPLAQEKTSPTLLYTKPSTPHKTSPTVHKHTTSMKPTPTTTILYSKPYRQTPRPMLSYYSHKDISSKNTTQRPYVKPLKESLGRPVNVYSNNEKVDDFSTESVNSLLTSQIKIRVGEYDFSKLEEPYPYQERGVVKKMVHPKYNFFTYEYDLALVRLETPVEFAPNIVPICLPGSDDLLIGENATVTGWGRLSEGGSLPPVLQKVTVPIVSNEKCRSMFLRAGRYEFISDIFMCAGFDNGGRDSCQGDSGGPLQVKGKDGRYFLAGIISWGIGCAEANLPGVCTRISKFVPWVLDTGDSGGPLQVKGKDGRYFLAGIISWGIGCAEANLPGVCTRISKFVPWVLDTVT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine proteinase stubble Hormone dependent protease required for epithelial morphogenesis, including the formation of bristles, legs, and wings. Has a dual function, detaches imaginal disk cells from extracellular matrices through its extracellular proteolytic domain and transmits an outside-to-inside signal to its intracellular domain to modify the cytoskeleton during morphogenesis.confidentQ05319

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0019538 [BP]protein metabolic processprobableGO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0051017 [BP]actin filament bundle assemblyprobableGO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0043933, GO:0009987, GO:0030036, GO:0044085, GO:0044763, GO:0016043, GO:0008150, GO:0071840
GO:0044469 [BP]envenomation resulting in positive regulation of blood coagulation in other organismprobableGO:0044468, GO:0044483, GO:0050896, GO:0007610, GO:0008150, GO:0035737, GO:0035738, GO:0051705, GO:0051704
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0035807 [BP]positive regulation of blood coagulation in other organismprobableGO:0032101, GO:0035806, GO:0051240, GO:0048583, GO:1900046, GO:0050789, GO:0008150, GO:0050820, GO:0061041, GO:0065007, GO:0050818, GO:0051239, GO:0048518, GO:0030193, GO:0080134, GO:0051704, GO:0065008, GO:1900048, GO:0035821, GO:0030194
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B9L, chain A
Confidence level:very confident
Coverage over the Query: 130-373
View the alignment between query and template
View the model in PyMOL
Template: 1FIW, chain A
Confidence level:confident
Coverage over the Query: 371-422
View the alignment between query and template
View the model in PyMOL
Template: 2IKD, chain A
Confidence level:probable
Coverage over the Query: 27-66
View the alignment between query and template
View the model in PyMOL