Diaphorina citri psyllid: psy15061


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLNDEVEHKPSMTSAAKSFVHTYNKSVEPADVYTSGMSVQNTRRVYQSVDIEEVPPSHHHHHHPVAPVSRDHDENKYKRRSIVEWISRWWM
ccccccccccccccccEEEEccccccccccccccEEEEccHHHHccccccccccccccccccccEEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHcccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcc
***CKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLN*************************************************************************YKRRSIVEWISRWWM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLNDEVEHKPSMTSAAKSFVHTYNKSVEPADVYTSGMSVQNTRRVYQSVDIEEVPPSHHHHHHPVAPVSRDHDENKYKRRSIVEWISRWWM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein-like 1 homolog confidentQ9N4Y9
Zinc finger protein-like 1 Required for cis-Golgi integrity and efficient ER to Golgi transport.confidentQ0VFM0
Zinc finger protein-like 1 Required for cis-Golgi integrity and efficient ER to Golgi transport. Involved in the maintenance of the integrity of the cis-Golgi, possibly via its interaction with GOLGA2/GM130.confidentQ9DB43

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V87, chain A
Confidence level:confident
Coverage over the Query: 35-105
View the alignment between query and template
View the model in PyMOL
Template: 3LRQ, chain A
Confidence level:confident
Coverage over the Query: 50-125
View the alignment between query and template
View the model in PyMOL