Psyllid ID: psy15061

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLNDEVEHKPSMTSAAKSFVHTYNKSVEPADVYTSGMSVQNTRRVYQSVDIEEVPPSHHHHHHPVAPVSRDHDENKYKRRSIVEWISRWWM
ccccccccccccccccEEEEccccccccccccccEEEEccHHHHccccccccccccccccccccEEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHcccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcc
ccccccccccccEEEEEEEEccccHHccccccccEEEHHHHHHHHcccccccccccccccccccEEEEEEcccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHHcc
mglckcpkrkvtnqfcYEHRVNVCEYCMVTNHPKCIVQSYLQWledsdynptcelcRKDLAAENCIRLTCYHVYHWSCLNhyarqlpsttapagykcpqcktglfppnnlvspVADVLREKLSSvnwarvglglpllndevehkpsmtsAAKSFVHTynksvepadvytsgmsvqntRRVYqsvdieevppshhhhhhpvapvsrdhdenkyKRRSIVEWISRWWM
mglckcpkrkvtnqfcYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLNDEVEHKPSMTSAAKSFVHTYNKSvepadvytsgmsvQNTRRVYQSVDIEEVPpshhhhhhpvapvsrdhdenkyKRRSIVEWISRWWM
MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLNDEVEHKPSMTSAAKSFVHTYNKSVEPADVYTSGMSVQNTRRVYQSVDIEEvppshhhhhhpvapvsRDHDENKYKRRSIVEWISRWWM
***CKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLND**************FVHTY********************************************************************
***C***KRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFP*********************************************************************************************************YKRRSIVEWISRWWM
MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLNDEVEHKPSMTSAAKSFVHTYNKSVEPADVYTSGMSVQNTRRVYQSVDIEEV*********************KYKRRSIVEWISRWWM
*GLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLN***********************************************************************NKYKRRSIVEWISRWWM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLNDEVEHKPSMTSAAKSFVHTYNKSVEPADVYTSGMSVQNTRRVYQSVDIEEVPPSHHHHHHPVAPVSRDHDENKYKRRSIVEWISRWWM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
Q2YDD3312 Zinc finger protein-like yes N/A 0.938 0.679 0.467 1e-60
A1L2S8320 Zinc finger protein-like N/A N/A 0.969 0.684 0.476 4e-60
O95159310 Zinc finger protein-like yes N/A 0.938 0.683 0.466 2e-59
Q0VFM0320 Zinc finger protein-like yes N/A 0.986 0.696 0.445 1e-58
A7S7Z9252 Zinc finger protein-like N/A N/A 0.818 0.734 0.471 3e-57
Q9DB43310 Zinc finger protein-like yes N/A 0.986 0.719 0.447 3e-57
Q16N38290 Zinc finger protein-like N/A N/A 0.955 0.744 0.483 1e-56
P62447317 Zinc finger protein-like yes N/A 0.938 0.668 0.446 1e-56
Q9VD26299 Zinc finger protein-like yes N/A 0.982 0.742 0.481 3e-55
B3P7K6298 Zinc finger protein-like N/A N/A 0.986 0.748 0.468 7e-55
>sp|Q2YDD3|ZFPL1_BOVIN Zinc finger protein-like 1 OS=Bos taurus GN=ZFPL1 PE=2 SV=1 Back     alignment and function desciption
 Score =  232 bits (592), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 121/259 (46%), Positives = 152/259 (58%), Gaps = 47/259 (18%)

Query: 1   MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDL 60
           MGLCKCPKRKVTN FC+EHRVNVCE+C+V NH KCIVQSYLQWL+DSDYNP C LC   L
Sbjct: 1   MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPL 60

Query: 61  AAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLRE 120
           AA    RL CY ++HW+CLN  A QLP  TAPAGY+CP C   +FPP NL  PVA  LRE
Sbjct: 61  AARETTRLICYDLFHWACLNERAAQLPRNTAPAGYQCPSCSGPIFPPTNLAGPVASALRE 120

Query: 121 KLSSVNWARVGLGLPLLNDEVEHKPS-MTSAAKSFVHTYNKSVEPADVYTSGMSV----- 174
           KL++VNWAR GLGLPL+++ V  +P  + ++  S   ++N S  P    T+  S      
Sbjct: 121 KLATVNWARAGLGLPLIDELVSPEPEPLNTSEFSDWSSFNASGSPEQEETASASAAPAFY 180

Query: 175 --------------QNT----------------RRVYQSVDIEEVPPSHHHHHHPVAPVS 204
                         Q+T                R+VY + D E  P  H           
Sbjct: 181 SQVPRPPASPSRPEQHTVIHMGNPEPLTHASAPRKVYDTRDDERAPGLH----------- 229

Query: 205 RDHDENKYKRRSIVEWISR 223
           RD D++KY+RR  + W+++
Sbjct: 230 RDCDDDKYRRRPALGWLAQ 248
Required for cis-Golgi integrity and efficient ER to Golgi transport. Involved in the maintenance of the integrity of the cis-Golgi, possibly via its interaction with GOLGA2/GM130.
Bos taurus (taxid: 9913)
>sp|A1L2S8|ZFPL1_XENLA Zinc finger protein-like 1 OS=Xenopus laevis GN=zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|O95159|ZFPL1_HUMAN Zinc finger protein-like 1 OS=Homo sapiens GN=ZFPL1 PE=1 SV=2 Back     alignment and function description
>sp|Q0VFM0|ZFPL1_XENTR Zinc finger protein-like 1 OS=Xenopus tropicalis GN=zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|A7S7Z9|ZFPL1_NEMVE Zinc finger protein-like 1 homolog OS=Nematostella vectensis GN=zfpl1 PE=3 SV=1 Back     alignment and function description
>sp|Q9DB43|ZFPL1_MOUSE Zinc finger protein-like 1 OS=Mus musculus GN=Zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|Q16N38|ZFPL1_AEDAE Zinc finger protein-like 1 homolog OS=Aedes aegypti GN=AAEL012105 PE=3 SV=1 Back     alignment and function description
>sp|P62447|ZFPL1_DANRE Zinc finger protein-like 1 OS=Danio rerio GN=zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VD26|ZFPL1_DROME Zinc finger protein-like 1 homolog OS=Drosophila melanogaster GN=CG5382 PE=1 SV=1 Back     alignment and function description
>sp|B3P7K6|ZFPL1_DROER Zinc finger protein-like 1 homolog OS=Drosophila erecta GN=GG12524 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
91086565291 PREDICTED: similar to zinc finger protei 0.977 0.759 0.579 7e-70
307195813322 Zinc finger protein-like 1 [Harpegnathos 0.938 0.658 0.522 8e-70
307177460319 Zinc finger protein-like 1 [Camponotus f 0.995 0.705 0.535 4e-69
332376693288 unknown [Dendroctonus ponderosae] 0.977 0.767 0.561 8e-68
357610265315 putative zinc finger like protein 1 isof 0.938 0.673 0.501 1e-67
350409614322 PREDICTED: zinc finger protein-like 1-li 0.938 0.658 0.498 6e-67
380024932320 PREDICTED: zinc finger protein-like 1-li 0.938 0.662 0.505 6e-67
332027644320 Zinc finger protein-like 1 [Acromyrmex e 0.995 0.703 0.515 7e-67
110756605320 PREDICTED: zinc finger protein-like 1-li 0.938 0.662 0.505 1e-66
383859889321 PREDICTED: zinc finger protein-like 1-li 0.938 0.660 0.503 1e-66
>gi|91086565|ref|XP_967047.1| PREDICTED: similar to zinc finger protein-like 1 isoform 1 [Tribolium castaneum] gi|270009770|gb|EFA06218.1| hypothetical protein TcasGA2_TC009067 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  269 bits (687), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 131/226 (57%), Positives = 159/226 (70%), Gaps = 5/226 (2%)

Query: 1   MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDL 60
           MGLCKCPKR+VTNQFC+EHRV VCE CMVTNHP C+VQSYLQWL+DSDYN  CELC K+L
Sbjct: 1   MGLCKCPKRRVTNQFCFEHRVCVCENCMVTNHPICVVQSYLQWLQDSDYNSICELCSKEL 60

Query: 61  AAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLRE 120
             E+ IRLTCYHV+HWSCL+H++RQLP TTAP GY CP CK+ LFPP+NL+SPVADVL+E
Sbjct: 61  NVEDSIRLTCYHVFHWSCLDHFSRQLPPTTAPRGYTCPSCKSPLFPPSNLISPVADVLKE 120

Query: 121 KLSSVNWARVGLGLPLLNDEVEHKPSMT-SAAKSFVHTYNKSVEPADVYTSGMSVQNTRR 179
           KL+ VNWAR GLGLPLL++E E K  +  +++ S   + N S    +V   G   +    
Sbjct: 121 KLAGVNWARAGLGLPLLSEEREVKAVVNHTSSVSTSKSPNPSHSVVNVEDQGAFSRTGAE 180

Query: 180 VYQSVDIEEVPPSHHHHHHPVAPVSRDHDENKYKRRSIVEWISRWW 225
            YQ+     +          V PV  DHDE+KYKRR   E +  WW
Sbjct: 181 AYQASSNRRI----FQDVREVKPVVFDHDEDKYKRRPASELMKTWW 222

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307195813|gb|EFN77627.1| Zinc finger protein-like 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307177460|gb|EFN66587.1| Zinc finger protein-like 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332376693|gb|AEE63486.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|357610265|gb|EHJ66902.1| putative zinc finger like protein 1 isoform 1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|350409614|ref|XP_003488794.1| PREDICTED: zinc finger protein-like 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380024932|ref|XP_003696240.1| PREDICTED: zinc finger protein-like 1-like [Apis florea] Back     alignment and taxonomy information
>gi|332027644|gb|EGI67712.1| Zinc finger protein-like 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|110756605|ref|XP_394555.2| PREDICTED: zinc finger protein-like 1-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383859889|ref|XP_003705424.1| PREDICTED: zinc finger protein-like 1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
UNIPROTKB|G5E5I4312 ZFPL1 "Zinc finger protein-lik 0.765 0.554 0.597 1.1e-60
UNIPROTKB|Q2YDD3312 ZFPL1 "Zinc finger protein-lik 0.765 0.554 0.597 1.1e-60
UNIPROTKB|F1RQT4312 ZFPL1 "Uncharacterized protein 0.765 0.554 0.586 4.8e-60
UNIPROTKB|O95159310 ZFPL1 "Zinc finger protein-lik 0.725 0.529 0.612 6.1e-60
ZFIN|ZDB-GENE-040426-1255317 zfpl1 "zinc finger protein-lik 0.676 0.482 0.636 5.4e-59
MGI|MGI:1891017310 Zfpl1 "zinc finger like protei 0.641 0.467 0.655 8.8e-59
UNIPROTKB|E2RS23312 ZFPL1 "Uncharacterized protein 0.725 0.525 0.606 8.8e-59
UNIPROTKB|E9PNY1207 ZFPL1 "Zinc finger protein-lik 0.725 0.792 0.612 2.5e-56
UNIPROTKB|E9PQ47188 ZFPL1 "Zinc finger protein-lik 0.725 0.872 0.612 2.5e-56
FB|FBgn0038950299 CG5382 [Drosophila melanogaste 0.619 0.468 0.657 4.8e-56
UNIPROTKB|G5E5I4 ZFPL1 "Zinc finger protein-like 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 586 (211.3 bits), Expect = 1.1e-60, Sum P(2) = 1.1e-60
 Identities = 104/174 (59%), Positives = 125/174 (71%)

Query:     1 MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDL 60
             MGLCKCPKRKVTN FC+EHRVNVCE+C+V NH KCIVQSYLQWL+DSDYNP C LC   L
Sbjct:     1 MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPL 60

Query:    61 AAENCIRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLRE 120
             AA    RL CY ++HW+CLN  A QLP  TAPAGY+CP C   +FPP NL  PVA  LRE
Sbjct:    61 AARETTRLICYDLFHWACLNERAAQLPRNTAPAGYQCPSCSGPIFPPTNLAGPVASALRE 120

Query:   121 KLSSVNWARVGLGLPLLNDEVEHKPSMTSAAK-SFVHTYNKSVEPADVYTSGMS 173
             KL++VNWAR GLGLPL+++ V  +P   + ++ S   ++N S  P    T+  S
Sbjct:   121 KLATVNWARAGLGLPLIDELVSPEPEPLNTSEFSDWSSFNASGSPEQEETASAS 174
GO:0005794 "Golgi apparatus" evidence=IEA
UNIPROTKB|Q2YDD3 ZFPL1 "Zinc finger protein-like 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQT4 ZFPL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O95159 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1255 zfpl1 "zinc finger protein-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1891017 Zfpl1 "zinc finger like protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RS23 ZFPL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PNY1 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PQ47 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0038950 CG5382 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9N4Y9ZFPL1_CAEELNo assigned EC number0.45220.97340.7119yesN/A
Q0VFM0ZFPL1_XENTRNo assigned EC number0.44530.98670.6968yesN/A
Q9DB43ZFPL1_MOUSENo assigned EC number0.44710.98670.7193yesN/A
P62447ZFPL1_DANRENo assigned EC number0.44690.93800.6687yesN/A
Q9VD26ZFPL1_DROMENo assigned EC number0.48130.98230.7424yesN/A
Q298N4ZFPL1_DROPSNo assigned EC number0.47100.98670.7384yesN/A
Q2YDD3ZFPL1_BOVINNo assigned EC number0.46710.93800.6794yesN/A
O95159ZFPL1_HUMANNo assigned EC number0.46690.93800.6838yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
KOG3970|consensus299 100.0
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.27
KOG4628|consensus348 99.2
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.87
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.83
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.82
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.78
PHA02929238 N1R/p28-like protein; Provisional 98.69
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.59
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.51
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.46
KOG0802|consensus543 98.43
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.37
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.35
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.32
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.2
KOG0317|consensus293 98.17
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.17
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.11
PF1463444 zf-RING_5: zinc-RING finger domain 98.03
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.03
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.0
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.94
KOG0320|consensus187 97.93
KOG1734|consensus328 97.89
KOG0823|consensus230 97.89
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.88
PHA02926242 zinc finger-like protein; Provisional 97.81
KOG1493|consensus84 97.8
KOG0828|consensus636 97.58
KOG1940|consensus276 97.54
KOG0827|consensus 465 97.4
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.38
KOG0804|consensus 493 97.32
KOG2164|consensus 513 97.27
KOG1952|consensus 950 97.23
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.22
KOG2930|consensus114 97.15
KOG2177|consensus 386 97.15
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.1
KOG0825|consensus 1134 97.05
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.03
KOG1941|consensus518 96.68
KOG1645|consensus 463 96.67
KOG0287|consensus 442 96.54
COG52191525 Uncharacterized conserved protein, contains RING Z 96.39
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.36
KOG0978|consensus698 95.98
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.83
KOG4445|consensus368 95.78
KOG3268|consensus234 95.74
KOG1428|consensus3738 95.7
KOG4265|consensus349 95.61
KOG0801|consensus205 95.1
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 94.82
KOG0824|consensus 324 94.51
KOG2034|consensus911 94.12
KOG1002|consensus791 94.05
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 93.69
KOG0311|consensus 381 93.48
PHA02862156 5L protein; Provisional 92.88
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 92.85
KOG4185|consensus 296 92.31
KOG2879|consensus298 92.28
KOG1039|consensus344 92.21
PHA02825162 LAP/PHD finger-like protein; Provisional 92.16
KOG1814|consensus445 91.91
KOG4172|consensus62 91.47
KOG2114|consensus933 91.42
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 91.13
KOG2660|consensus 331 90.85
KOG0309|consensus1081 90.79
KOG1785|consensus563 90.34
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 90.22
KOG2817|consensus394 89.44
PF04641260 Rtf2: Rtf2 RING-finger 89.13
COG5152259 Uncharacterized conserved protein, contains RING a 88.09
KOG3039|consensus303 86.29
KOG1813|consensus313 85.49
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 85.3
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 85.16
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 84.89
KOG3053|consensus293 84.84
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 84.65
KOG1571|consensus355 84.15
KOG4159|consensus 398 83.28
KOG0297|consensus 391 83.06
PF13901202 DUF4206: Domain of unknown function (DUF4206) 81.39
KOG3800|consensus 300 80.72
PF0064342 zf-B_box: B-box zinc finger; InterPro: IPR000315 Z 80.36
>KOG3970|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-85  Score=577.32  Aligned_cols=207  Identities=57%  Similarity=1.087  Sum_probs=180.0

Q ss_pred             CccccCCCCcccccceeeeccccccccccCCCCcceeeeehhhccCCCCCCcCccccccccCCCceeecCCCccCHHHHH
Q psy15061          1 MGLCKCPKRKVTNQFCYEHRVNVCEYCMVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLN   80 (226)
Q Consensus         1 MglCkc~krk~T~~fCf~HrvnVCe~C~v~~H~~CvVqSYlqWL~DsDyd~~C~IC~~~L~~gd~vRL~C~HvFH~~CLd   80 (226)
                      |||||||||||||||||||||||||+|||.||++||||||+|||+||||+++|.+|...|+.||++||.|||+|||+||+
T Consensus         1 MGLCKCPKRkVTNlFCfEHRVNVCEhClV~nHpkCiVQSYLqWL~DsDY~pNC~LC~t~La~gdt~RLvCyhlfHW~Cln   80 (299)
T KOG3970|consen    1 MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHPKCIVQSYLQWLQDSDYNPNCRLCNTPLASGDTTRLVCYHLFHWKCLN   80 (299)
T ss_pred             CCcccCchhhhhhhhhhhhhhhHHHHHHhccCchhhHHHHHHHHhhcCCCCCCceeCCccccCcceeehhhhhHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCCCCCCCCCCCCCCCCCCCCCCCCChHHHHHHHHhhhhhhhhhhcCCCCCCCCCCCCC-----CCCCCCcccc
Q psy15061         81 HYARQLPSTTAPAGYKCPQCKTGLFPPNNLVSPVADVLREKLSSVNWARVGLGLPLLNDEVEHKP-----SMTSAAKSFV  155 (226)
Q Consensus        81 ~wl~~~p~nTapag~~CP~C~~~I~P~~n~~Spva~~Lre~laq~~War~glgl~l~~e~~~~~~-----~~~~~~~~~~  155 (226)
                      +|..++|+||||+||+||.|+.+|||+.|++|||+++|||+|+|+||||+|||||+|+|+++|.+     +..++|+.++
T Consensus        81 eraA~lPanTAPaGyqCP~Cs~eiFPp~NlvsPva~aLre~L~qvNWaRagLGLpll~E~~sp~p~p~~p~~~s~~~~~n  160 (299)
T KOG3970|consen   81 ERAANLPANTAPAGYQCPCCSQEIFPPINLVSPVAEALREQLKQVNWARAGLGLPLLPELNSPVPSPAPPQLKSAPVMHN  160 (299)
T ss_pred             HHHhhCCCcCCCCcccCCCCCCccCCCccccchhHHHHHHHHHhhhHHhhccCCccchhhcCCCCCCCChhhccchhhhc
Confidence            99999999999999999999999999999999999999999999999999999999999988654     3456666654


Q ss_pred             ccC--CCCCCC---------------C-e--eeec-----CCccccccceeccccCCCCCCCCCCCCCCCCCCCCCCCCc
Q psy15061        156 HTY--NKSVEP---------------A-D--VYTS-----GMSVQNTRRVYQSVDIEEVPPSHHHHHHPVAPVSRDHDEN  210 (226)
Q Consensus       156 ~~~--~~~~~~---------------p-~--~~~~-----~~~~~~~rk~~~~~~~~~~~~~~~~~~~~~~~~~~d~d~~  210 (226)
                      .+.  +..+++               | |  +.|+     +.+.+.+|++|+.|+.                   ..|||
T Consensus       161 ~~~vh~~~S~~~a~~~~~~~~~~~~sp~h~V~~m~~~Np~p~s~a~tR~~l~~R~g-------------------D~ddn  221 (299)
T KOG3970|consen  161 EVPVHNNRSSTPATHLEMEDTASYSSPNHDVTFMRKKNPGPESSADTRPLLQLRDG-------------------DNDDN  221 (299)
T ss_pred             CCCccccCCCCcccccccCCCCCCCCCCCceEeeccCCCCccccCCcCccccccCC-------------------Ccccc
Confidence            332  111111               2 1  1222     3333445777766532                   47999


Q ss_pred             cccCCCHHHHHHHhhC
Q psy15061        211 KYKRRSIVEWISRWWM  226 (226)
Q Consensus       211 kykrr~~~~w~~~~~~  226 (226)
                      ||||||+++||+||||
T Consensus       222 KY~RRp~~~w~~rl~R  237 (299)
T KOG3970|consen  222 KYKRRPTMDWMRRLWR  237 (299)
T ss_pred             hhhcCChHHHHHHHHH
Confidence            9999999999999997

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG0801|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG3053|consensus Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-04
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
 Score = 40.1 bits (93), Expect = 3e-04
 Identities = 15/84 (17%), Positives = 29/84 (34%), Gaps = 9/84 (10%)

Query: 28  MVTNHPKCIVQSYLQWLEDSDYNPTCELCRKDLAAENCIRLTCYHVYHWSCLNHYARQLP 87
              +H K   + Y  + E       C++C ++   ++     C H+   SCL  +     
Sbjct: 310 TPQDHIKVTQEQYELYCEMGSTFQLCKICAEN--DKDVKIEPCGHLMCTSCLTSWQESEG 367

Query: 88  STTAPAGYKCPQCKTGLFPPNNLV 111
                    CP C+  +     +V
Sbjct: 368 QG-------CPFCRCEIKGTEPIV 384
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.35
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.31
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.3
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.3
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.26
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.26
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.24
2ect_A78 Ring finger protein 126; metal binding protein, st 99.23
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.13
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.08
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.04
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.03
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.02
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.01
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.01
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.0
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.0
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.98
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.98
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.96
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.96
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.96
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.95
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.94
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.9
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.9
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.9
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.89
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.87
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.86
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.84
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.83
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.82
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.81
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.81
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.81
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.8
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.77
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.77
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.74
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.74
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.73
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.65
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.64
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.63
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.45
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.44
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.36
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.36
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.33
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.32
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.29
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.25
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.23
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.22
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.22
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.2
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.16
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.12
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.11
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.03
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.97
2ea5_A68 Cell growth regulator with ring finger domain prot 97.58
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.44
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.38
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.38
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.04
3nw0_A238 Non-structural maintenance of chromosomes element 97.0
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.16
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 95.4
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 92.06
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.79
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 88.19
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 87.6
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 86.81
1wil_A89 KIAA1045 protein; ring finger domain, structural g 86.35
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 84.63
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 84.2
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 84.19
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 83.8
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 82.95
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 82.2
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 81.84
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 81.07
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 80.34
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 80.27
1we9_A64 PHD finger family protein; structural genomics, PH 80.19
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.35  E-value=8.5e-13  Score=93.44  Aligned_cols=57  Identities=21%  Similarity=0.522  Sum_probs=47.1

Q ss_pred             CCCCCcCccccccccCCCc-eeecCCCccCHHHHHHHHHhCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy15061         47 SDYNPTCELCRKDLAAENC-IRLTCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLFPPNNLV  111 (226)
Q Consensus        47 sDyd~~C~IC~~~L~~gd~-vRL~C~HvFH~~CLd~wl~~~p~nTapag~~CP~C~~~I~P~~n~~  111 (226)
                      .+.+..|+||++.|.+++. +.|+|+|+||..||.+|++...        +||+|+++|.+...+.
T Consensus        12 ~~~~~~C~IC~~~~~~~~~~~~~~C~H~f~~~Ci~~~~~~~~--------~CP~Cr~~~~~~~~~~   69 (74)
T 2ep4_A           12 LNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRK--------VCPLCNMPVLQLAQLS   69 (74)
T ss_dssp             CCCSCBCSSSCCBCCSSSCEEEETTTEEEEHHHHHHHHHHCS--------BCTTTCCBCSSCCSCC
T ss_pred             CCCCCCCcCCCcccCCCCcEEEcCCCCEecHHHHHHHHHcCC--------cCCCcCcccccccccC
Confidence            3456899999999988765 4579999999999999998742        6999999998765543
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 226
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 3e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 0.002
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 36.6 bits (84), Expect = 3e-04
 Identities = 15/75 (20%), Positives = 24/75 (32%), Gaps = 4/75 (5%)

Query: 52  TCELCRKDLAAENCIRLT-CYHVYHWSCLNHYARQLPSTTAPAGYKCPQCK---TGLFPP 107
            C+LC  +   E    +  C  ++   CL  Y   L          CP       G    
Sbjct: 7   GCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQE 66

Query: 108 NNLVSPVADVLREKL 122
           N +   VA  + ++ 
Sbjct: 67  NEIECMVAAEIMQRY 81
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.33
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.3
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.19
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.11
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.05
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.05
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.04
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.82
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.82
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.79
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.69
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.69
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.68
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.64
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.26
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.76
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 94.59
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 92.12
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 90.92
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 90.75
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 89.82
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 89.17
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 81.39
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 80.5
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.33  E-value=2.5e-13  Score=92.71  Aligned_cols=48  Identities=23%  Similarity=0.596  Sum_probs=40.8

Q ss_pred             CCcCccccccccCCCce-ee-cCCCccCHHHHHHHHHhCCCCCCCCCCCCCCCCCCCC
Q psy15061         50 NPTCELCRKDLAAENCI-RL-TCYHVYHWSCLNHYARQLPSTTAPAGYKCPQCKTGLF  105 (226)
Q Consensus        50 d~~C~IC~~~L~~gd~v-RL-~C~HvFH~~CLd~wl~~~p~nTapag~~CP~C~~~I~  105 (226)
                      +..|+||+++|.+|+.+ +| .|+|+||.+||++|++..        .+||+||++|.
T Consensus         5 ~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~--------~~CP~CR~~i~   54 (55)
T d1iyma_           5 GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSH--------STCPLCRLTVV   54 (55)
T ss_dssp             SCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTC--------CSCSSSCCCSC
T ss_pred             CCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhC--------CcCCCCCCEeE
Confidence            45799999999998755 56 599999999999999863        25999999875
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure