Diaphorina citri psyllid: psy15062

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----
MSPGLNGIANAGNTCYINSVLQCLSNTPAFRNVLLNEDIPIHPDSKSQGQLVDALVNFMKMMWSSGNLVLNTKAILLALRSYTKKFDGNQQQDAQEFLLYLLAALNEEAKVVPDQYNGSTYSNTSSKQVGSFRALHYWEKFQTTEASVFSDIFVGQLRSSVRCSNCKRTSTVYEIFWELSLPVPPGGGTLYECQLRSSVRCSNCKRTSTVYEIFWELSLPVPPGGGTLYECLNKFFNGETLHNTCQYCKKQSDLVKLYEIQRLPPVLILWFKRFSSNFTQKVTSPIKFPREGLDMEYYISASGRRVESRYTYDLCAVSNHIGKTALYGHYTAYCRREGTGRWYLYDDTVVSPVDAQTVESAEAEHGAYILVYQRR
cccccccccccccHHHHHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccccccEEEEcEEECcCEEEccccccEEEccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccHHHHHHHHcccccccccccccccccccEEEEEEcccccEEEEEEEcccccccccccccEEccccccccccccccccccccccCEEEEEEEEECccccccccEEEEEEECcccccEEEEccccEECccccccccccccccEEEEEEEEc
*SPGLNGIANAGNTCYINSVLQCLSNTPAFRNVLLNEDIPIHPD**SQGQLVDALVNFMKMMWSSGNLVLNTKAILLALRSYTKKFDGNQQQDAQEFLLYLLAALNEEAKVVPDQ************QVGSFRALHYWEKFQTTEASVFSDIFVGQLRSSVRCSNCKRTSTVYEIFWELSLPVPPGGG***************CKRTSTVYEIFWELSLPVPPGGGTLYECLNKFFNGETLHNTCQYCKKQSDLVKLYEIQRLPPVLILWFKRFSSNFTQKVTSPIKFPREGLDMEYYISASGRRVESRYTYDLCAVSNHIGKTALYGHYTAYCRREGTGRWYLYDDTVVSPVDAQTVESAEAEHGAYILVYQRR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPGLNGIANAGNTCYINSVLQCLSNTPAFRNVLLNEDIPIHPDSKSQGQLVDALVNFMKMMWSSGNLVLNTKAILLALRSYTKKFDGNQQQDAQEFLLYLLAALNEEAKVVPDQYNGSTYSNTSSKQVGSFRALHYWEKFQTTEASVFSDIFVGQLRSSVRCSNCKRTSTVYEIFWELSLPVPPGGGTLYECQLRSSVRCSNCKRTSTVYEIFWELSLPVPPGGGTLYECLNKFFNGETLHNTCQYCKKQSDLVKLYEIQRLPPVLILWFKRFSSNFTQKVTSPIKFPREGLDMEYYISASGRRVESRYTYDLCAVSNHIGKTALYGHYTAYCRREGTGRWYLYDDTVVSPVDAQTVESAEAEHGAYILVYQRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 2 Hydrolase that deubiquitinates polyubiquitinated target proteins such as MDM2, MDM4 and CCND1. Possesses both ubiquitin-specific peptidase and isopeptidase activities.confidentO57429

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0004843 [MF]ubiquitin-specific protease activityprobableGO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0016579 [BP]protein deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y6E, chain A
Confidence level:very confident
Coverage over the Query: 16-185,225-375
View the alignment between query and template
View the model in PyMOL
Template: 3V6C, chain A
Confidence level:confident
Coverage over the Query: 4-156,195-373
View the alignment between query and template
View the model in PyMOL