Diaphorina citri psyllid: psy15063

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
MLSFEDKVKQIKEILAQLSPSDYSEDNGSDDYDYYDEELPEQLKYLTLFEEKYGKGRGNGGSISDPFYKGSKDIMGDSSTTGTGLDVNITYSCGDVSKERVTYFKSPHHPARPSSGLTCDYDVAIRQDVCAVRIEFEKVNLARKVGGVCDIDQLRDTPVSELVLHLGDHDLTQLNETSHVRRGVRRVLFHSHFHPFVLSNDIALLQLDRPVPLTGTIQPVCLPQKGESFIGKRGHVVGWGVTSFPMGEPSPTLQKLEVKVLSNARCSTVIEESIGIGMLCAAPDETQGTCFVPVSPVGYTKKHLQQFHQGTTYRQPRRRIILGGEADIGEFPWQVAIALDGMFFCGGALLNEHFVLTAAHCIMTGGPLTFEQDGYHVLAGIVSYGVTGCAIMPSYPDLYTRVSEYIRWIHVNAIVTK
cccHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEECcccEEcccEEEEcEEEEEEccEEECccEEEEEccccccccccEEEEEEccECccccccccEEEEEEEEEEEccccccccccccCEEEECcccccccccccccccccccccccccEEEEEEcccccccccccccccEEEEEEEEcHHHHHHHHcccccccEEEcccccccccccccccccccccccccEEEccccccccccccccccccccccccHHHEEccccEEEcccEEEEccEEEEEEccccccccEEECcccEEEEEccEEEEEEEEECccccccEEEEccccccHHHHHHcccc
*****DKVKQIKEILA**********NGSDDYDYYDEELPEQLKYLTLFEEKYG***************************GTGLDVNITYSCGDVSKERVTYFKSPHHPARPSSGLTCDYDVAIRQDVCAVRIEFEKVNLARKVGGVCDIDQLRDTPVSELVLHLGDHDLTQLNETSHVRRGVRRVLFHSHFHPFVLSNDIALLQLDRPVPLTGTIQPVCLPQKGESFIGKRGHVVGWGVTSFPMGEPSPTLQKLEVKVLSNARCSTVIEESIGIGMLCAAPDETQGTCFVPVSPVGYTKKHLQQFHQGTTYRQPRRRIILGGEADIGEFPWQVAIALDGMFFCGGALLNEHFVLTAAHCIMTGGPLTFEQDGYHVLAGIVSYGVTGCAIMPSYPDLYTRVSEYIRWIHVNAIV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSFEDKVKQIKEILAQLSPSDYSEDNGSDDYDYYDEELPEQLKYLTLFEEKYGKGRGNGGSISDPFYKGSKDIMGDSSTTGTGLDVNITYSCGDVSKERVTYFKSPHHPARPSSGLTCDYDVAIRQDVCAVRIEFEKVNLARKVGGVCDIDQLRDTPVSELVLHLGDHDLTQLNETSHVRRGVRRVLFHSHFHPFVLSNDIALLQLDRPVPLTGTIQPVCLPQKGESFIGKRGHVVGWGVTSFPMGEPSPTLQKLEVKVLSNARCSTVIEESIGIGMLCAAPDETQGTCFVPVSPVGYTKKHLQQFHQGTTYRQPRRRIILGGEADIGEFPWQVAIALDGMFFCGGALLNEHFVLTAAHCIMTGGPLTFEQDGYHVLAGIVSYGVTGCAIMPSYPDLYTRVSEYIRWIHVNAIVTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008233 [MF]peptidase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F83, chain A
Confidence level:very confident
Coverage over the Query: 87-292,363-413
View the alignment between query and template
View the model in PyMOL
Template: 2WPH, chain S
Confidence level:very confident
Coverage over the Query: 320-369
View the alignment between query and template
View the model in PyMOL
Template: 1PFX, chain C
Confidence level:probable
Coverage over the Query: 158-258,283-310,341-348,364-409
View the alignment between query and template
View the model in PyMOL