Diaphorina citri psyllid: psy15066


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--
MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCVMAPY
ccEEEEEEEEEHccccEECccccccHHHHHccccccccccHHHHHHHHHHcccccccccccc
MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCV****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCVMAPY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glyoxal reductase Reduces glyoxal and methylglyoxal. Is not involved in the vitamin B6 biosynthesis.confidentO32210

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001758 [MF]retinal dehydrogenase activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0034754 [BP]cellular hormone metabolic processprobableGO:0042445, GO:0009987, GO:0044237, GO:0010817, GO:0008150, GO:0008152, GO:0065007, GO:0065008
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0046164 [BP]alcohol catabolic processprobableGO:0044712, GO:1901575, GO:0008152, GO:0009056, GO:0044710, GO:0006066, GO:0071704, GO:0008150, GO:0044281, GO:0044282, GO:1901616, GO:1901615
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006721 [BP]terpenoid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006720, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044255
GO:0016042 [BP]lipid catabolic processprobableGO:0044238, GO:1901575, GO:0006629, GO:0044710, GO:0071704, GO:0008150, GO:0008152, GO:0009056
GO:0033764 [MF]steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptorprobableGO:0016229, GO:0016614, GO:0016616, GO:0003824, GO:0003674, GO:0016491
GO:0008202 [BP]steroid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360
GO:0006081 [BP]cellular aldehyde metabolic processprobableGO:0044710, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F40, chain A
Confidence level:very confident
Coverage over the Query: 1-61
View the alignment between query and template
View the model in PyMOL