Psyllid ID: psy15066

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--
MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCVMAPY
ccEEEEEEEEEHccccEEEcccccHHHHHHccccccccccHHHHHHHHHHcccccccccccc
cHHHHHHHHHHHHcccEEccEccccccHHHHHccccccccHHHHHHHHcccccccccccccc
mfmtsfilrpqvqsgtipipksntvkriTENINVfdftleqsdvdkIDALDkkqrscvmapy
mfmtsfilrpqvqsgtipipksntvkriTENINVFdftleqsdvdkidaldkkqrscvmapy
MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCVMAPY
******IL*******TIPIPKSNTVKRITENINVFDFTLEQS********************
MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCV****
MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCVMAPY
MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCV****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCVMAPY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query62 2.2.26 [Sep-21-2011]
O32210276 Glyoxal reductase OS=Baci yes N/A 0.790 0.177 0.551 2e-08
O34678280 Uncharacterized oxidoredu no N/A 0.854 0.189 0.490 2e-07
Q54NZ7311 Aldose reductase B OS=Dic yes N/A 0.806 0.160 0.46 3e-07
Q568L5324 Alcohol dehydrogenase [NA yes N/A 0.838 0.160 0.5 8e-07
P51635325 Alcohol dehydrogenase [NA yes N/A 0.838 0.16 0.5 2e-06
Q8VCX1325 3-oxo-5-beta-steroid 4-de yes N/A 0.790 0.150 0.469 2e-06
P50578325 Alcohol dehydrogenase [NA yes N/A 0.838 0.16 0.5 3e-06
Q9GV41276 Prostaglandin F synthase N/A N/A 0.790 0.177 0.448 5e-06
Q9DCT1301 1,5-anhydro-D-fructose re no N/A 0.790 0.162 0.489 5e-06
Q5R5D5325 Alcohol dehydrogenase [NA yes N/A 0.838 0.16 0.480 6e-06
>sp|O32210|GR_BACSU Glyoxal reductase OS=Bacillus subtilis (strain 168) GN=yvgN PE=1 SV=1 Back     alignment and function desciption
 Score = 58.2 bits (139), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 34/49 (69%)

Query: 7   ILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQR 55
           ILR  +Q G + IPKS    RI EN ++FDF L Q D+DKIDAL+K +R
Sbjct: 218 ILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALNKDER 266
Reduces glyoxal and methylglyoxal. Is not involved in the vitamin B6 biosynthesis.
Bacillus subtilis (strain 168) (taxid: 224308)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 8EC: 3
>sp|O34678|YTBE_BACSU Uncharacterized oxidoreductase YtbE OS=Bacillus subtilis (strain 168) GN=ytbE PE=1 SV=1 Back     alignment and function description
>sp|Q54NZ7|ALRB_DICDI Aldose reductase B OS=Dictyostelium discoideum GN=alrB PE=3 SV=2 Back     alignment and function description
>sp|Q568L5|A1A1B_DANRE Alcohol dehydrogenase [NADP(+)] B OS=Danio rerio GN=akr1a1b PE=2 SV=1 Back     alignment and function description
>sp|P51635|AK1A1_RAT Alcohol dehydrogenase [NADP(+)] OS=Rattus norvegicus GN=Akr1a1 PE=1 SV=2 Back     alignment and function description
>sp|Q8VCX1|AK1D1_MOUSE 3-oxo-5-beta-steroid 4-dehydrogenase OS=Mus musculus GN=Akr1d1 PE=2 SV=1 Back     alignment and function description
>sp|P50578|AK1A1_PIG Alcohol dehydrogenase [NADP(+)] OS=Sus scrofa GN=AKR1A1 PE=1 SV=2 Back     alignment and function description
>sp|Q9GV41|PGFS_TRYBB Prostaglandin F synthase OS=Trypanosoma brucei brucei PE=1 SV=1 Back     alignment and function description
>sp|Q9DCT1|AKCL2_MOUSE 1,5-anhydro-D-fructose reductase OS=Mus musculus GN=Akr1e2 PE=1 SV=1 Back     alignment and function description
>sp|Q5R5D5|AK1A1_PONAB Alcohol dehydrogenase [NADP(+)] OS=Pongo abelii GN=AKR1A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
414152635 281 putative oxidoreductase [Desulfotomaculu 0.870 0.192 0.537 2e-07
432341218 275 aldo-keto reductase [Rhodococcus wratisl 0.870 0.196 0.462 3e-07
384102447 275 aldo-keto reductase [Rhodococcus imteche 0.870 0.196 0.462 3e-07
424861439 275 aldo/keto reductase [Rhodococcus opacus 0.870 0.196 0.462 5e-07
419964328 275 aldo-keto reductase [Rhodococcus opacus 0.870 0.196 0.462 5e-07
110636347 253 aldo/keto reductase [Chelativorans sp. B 0.903 0.221 0.446 5e-07
73662667 276 aldo keto reductase [Staphylococcus sapr 0.758 0.170 0.510 6e-07
228311967 275 Chain A, Crystal Structure Of Yvgn And C 0.790 0.178 0.551 7e-07
418576220 276 putative aldo keto reductase [Staphyloco 0.758 0.170 0.510 7e-07
16080393 276 glyoxal/methylglyoxal reductase [Bacillu 0.790 0.177 0.551 7e-07
>gi|414152635|ref|ZP_11408964.1| putative oxidoreductase [Desulfotomaculum hydrothermale Lam5 = DSM 18033] gi|411455825|emb|CCO06864.1| putative oxidoreductase [Desulfotomaculum hydrothermale Lam5 = DSM 18033] Back     alignment and taxonomy information
 Score = 59.7 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 36/54 (66%)

Query: 3   MTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRS 56
           +   ILR  VQ G + IPKS   +RI ENIN+FDF L   D+DKI ALDKK+ +
Sbjct: 210 VAQIILRWLVQRGVVAIPKSVRKERIVENINIFDFELSSEDMDKIAALDKKESA 263

Source: Desulfotomaculum hydrothermale Lam5 = DSM 18033

Species: Desulfotomaculum hydrothermale

Genus: Desulfotomaculum

Family: Peptococcaceae

Order: Clostridiales

Class: Clostridia

Phylum: Firmicutes

Superkingdom: Bacteria
>gi|432341218|ref|ZP_19590588.1| aldo-keto reductase [Rhodococcus wratislaviensis IFP 2016] gi|430773751|gb|ELB89409.1| aldo-keto reductase [Rhodococcus wratislaviensis IFP 2016] Back     alignment and taxonomy information
>gi|384102447|ref|ZP_10003461.1| aldo-keto reductase [Rhodococcus imtechensis RKJ300] gi|383840170|gb|EID79490.1| aldo-keto reductase [Rhodococcus imtechensis RKJ300] Back     alignment and taxonomy information
>gi|424861439|ref|ZP_18285385.1| aldo/keto reductase [Rhodococcus opacus PD630] gi|356659911|gb|EHI40275.1| aldo/keto reductase [Rhodococcus opacus PD630] Back     alignment and taxonomy information
>gi|419964328|ref|ZP_14480285.1| aldo-keto reductase [Rhodococcus opacus M213] gi|414570153|gb|EKT80889.1| aldo-keto reductase [Rhodococcus opacus M213] Back     alignment and taxonomy information
>gi|110636347|ref|YP_676555.1| aldo/keto reductase [Chelativorans sp. BNC1] gi|110287331|gb|ABG65390.1| aldo/keto reductase [Chelativorans sp. BNC1] Back     alignment and taxonomy information
>gi|73662667|ref|YP_301448.1| aldo keto reductase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] gi|72495182|dbj|BAE18503.1| putative aldo keto reductase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] Back     alignment and taxonomy information
>gi|228311967|pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis gi|228311968|pdb|3D3F|B Chain B, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Back     alignment and taxonomy information
>gi|418576220|ref|ZP_13140366.1| putative aldo keto reductase [Staphylococcus saprophyticus subsp. saprophyticus KACC 16562] gi|379325282|gb|EHY92414.1| putative aldo keto reductase [Staphylococcus saprophyticus subsp. saprophyticus KACC 16562] Back     alignment and taxonomy information
>gi|16080393|ref|NP_391220.1| glyoxal/methylglyoxal reductase [Bacillus subtilis subsp. subtilis str. 168] gi|221311290|ref|ZP_03593137.1| hypothetical protein Bsubs1_18136 [Bacillus subtilis subsp. subtilis str. 168] gi|221315617|ref|ZP_03597422.1| hypothetical protein BsubsN3_18052 [Bacillus subtilis subsp. subtilis str. NCIB 3610] gi|221320533|ref|ZP_03601827.1| hypothetical protein BsubsJ_18020 [Bacillus subtilis subsp. subtilis str. JH642] gi|221324817|ref|ZP_03606111.1| hypothetical protein BsubsS_18171 [Bacillus subtilis subsp. subtilis str. SMY] gi|452912913|ref|ZP_21961541.1| glyoxal reductase [Bacillus subtilis MB73/2] gi|81555946|sp|O32210.1|GR_BACSU RecName: Full=Glyoxal reductase; Short=GR; AltName: Full=Methylglyoxal reductase gi|215261458|pdb|3F7J|A Chain A, B.Subtilis Yvgn gi|215261459|pdb|3F7J|B Chain B, B.Subtilis Yvgn gi|2635853|emb|CAB15345.1| glyoxal/methylglyoxal reductase [Bacillus subtilis subsp. subtilis str. 168] gi|2832788|emb|CAA11712.1| putative reductase protein, YvgN [Bacillus subtilis] gi|407962178|dbj|BAM55418.1| glyoxal/methylglyoxal reductase [Bacillus subtilis BEST7613] gi|407966192|dbj|BAM59431.1| glyoxal/methylglyoxal reductase [Bacillus subtilis BEST7003] gi|452117941|gb|EME08335.1| glyoxal reductase [Bacillus subtilis MB73/2] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
DICTYBASE|DDB_G0285053311 alrB "aldo-keto reductase" [Di 0.806 0.160 0.46 2.9e-07
UNIPROTKB|J9PA75289 AKR1E2 "Uncharacterized protei 0.854 0.183 0.490 3.2e-07
UNIPROTKB|F1PYG1301 AKR1E2 "Uncharacterized protei 0.854 0.176 0.490 3.5e-07
UNIPROTKB|J9NSI8323 AKR1E2 "Uncharacterized protei 0.854 0.164 0.490 4.1e-07
ZFIN|ZDB-GENE-050417-118326 akr1a1b "aldo-keto reductase f 0.838 0.159 0.5 6.9e-07
MGI|MGI:2384785325 Akr1d1 "aldo-keto reductase fa 0.790 0.150 0.469 1.9e-06
MGI|MGI:1914758301 Akr1e1 "aldo-keto reductase fa 0.790 0.162 0.489 2.7e-06
TIGR_CMR|BA_3446279 BA_3446 "oxidoreductase, aldo/ 0.790 0.175 0.489 2.9e-06
TIGR_CMR|BA_5308279 BA_5308 "oxidoreductase, aldo/ 0.790 0.175 0.489 2.9e-06
UNIPROTKB|F1PK43325 AKR1A1 "Uncharacterized protei 0.838 0.16 0.5 3.1e-06
DICTYBASE|DDB_G0285053 alrB "aldo-keto reductase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 123 (48.4 bits), Expect = 2.9e-07, P = 2.9e-07
 Identities = 23/50 (46%), Positives = 32/50 (64%)

Query:    13 QSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCVMAPY 62
             Q G + IPKS+   RI EN N+FDF L   D+DKI++L+   R+C  A +
Sbjct:   255 QRGIVTIPKSSNPARIIENFNIFDFQLSNEDMDKINSLNSNLRTCTPANF 304
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0004032 "alditol:NADP+ 1-oxidoreductase activity" evidence=IEA;ISS
UNIPROTKB|J9PA75 AKR1E2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PYG1 AKR1E2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSI8 AKR1E2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-118 akr1a1b "aldo-keto reductase family 1, member A1b (aldehyde reductase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2384785 Akr1d1 "aldo-keto reductase family 1, member D1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:1914758 Akr1e1 "aldo-keto reductase family 1, member E1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3446 BA_3446 "oxidoreductase, aldo/keto reductase family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5308 BA_5308 "oxidoreductase, aldo/keto reductase family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK43 AKR1A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O32210GR_BACSU1, ., 1, ., 1, ., 2, 8, 30.55100.79030.1775yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 4e-14
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 7e-12
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 2e-09
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 7e-08
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
 Score = 63.4 bits (155), Expect = 4e-14
 Identities = 24/50 (48%), Positives = 30/50 (60%)

Query: 7   ILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRS 56
            LR  +Q G I IPKS T +RI EN+  FDF L + D+  IDALD+    
Sbjct: 219 ALRWHIQRGVIVIPKSTTPERIRENLAAFDFELSEEDMAAIDALDRGYGR 268

Length = 280
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 62
KOG1577|consensus300 99.73
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 99.71
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 99.61
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 99.57
KOG1575|consensus336 99.48
PRK10625346 tas putative aldo-keto reductase; Provisional 99.44
PRK10376290 putative oxidoreductase; Provisional 99.42
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 99.42
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 99.4
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 99.4
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 99.28
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 99.2
PLN02587314 L-galactose dehydrogenase 99.2
PRK14863292 bifunctional regulator KidO; Provisional 98.97
COG4989298 Predicted oxidoreductase [General function predict 98.73
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 97.97
KOG1576|consensus342 92.69
>KOG1577|consensus Back     alignment and domain information 
Probab=99.73  E-value=1.3e-17  Score=106.12  Aligned_cols=56  Identities=39%  Similarity=0.615  Sum_probs=53.6

Q ss_pred             CCHHHHHHHHHHhCCCeEecCCCCHHHHHHhHhccCCCCCHHHHHHHHhhhcCCcc
Q psy15066          1 MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRS   56 (62)
Q Consensus         1 ~s~aqval~W~l~~~~~~I~g~~~~~~l~~n~~~~~~~L~~e~~~~l~~~~~~~r~   56 (62)
                      .|+|||+|+|.+++|+++||+|++++||++|+++++|+|++|||+.|++++.++|+
T Consensus       234 kt~aQIlLrw~~q~g~~vipKS~~~~Ri~eN~~vfdf~Lt~ed~~~i~~~~~~~r~  289 (300)
T KOG1577|consen  234 KTPAQILLRWALQRGVSVIPKSSNPERIKENFKVFDFELTEEDMKKLDSLNSNERY  289 (300)
T ss_pred             CCHHHHHHHHHHhCCcEEEeccCCHHHHHHHHhhccccCCHHHHHHHhhcccccee
Confidence            48999999999999999999999999999999999999999999999999988874

>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>KOG1575|consensus Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
3d3f_A275 Crystal Structure Of Yvgn And Cofactor Nadph From B 1e-09
3f7j_A276 B.Subtilis Yvgn Length = 276 1e-09
3b3d_A314 B.Subtilis Ytbe Length = 314 2e-08
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 2e-07
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 2e-07
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 2e-07
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 2e-07
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 3e-07
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 4e-07
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 5e-07
3uzw_A346 Crystal Structure Of 5beta-Reductase (Akr1d1) E120h 6e-07
3cmf_A346 Crystal Structure Of Human Liver 5beta-Reductase (A 6e-07
2alr_A324 Aldehyde Reductase Length = 324 6e-07
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 6e-07
3bur_A326 Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- 8e-07
3qkz_A316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 1e-06
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 2e-06
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 2e-06
3o3r_A316 Crystal Structure Of Akr1b14 In Complex With Nadp L 6e-06
1q13_A323 Crystal Structure Of Rabbit 20alpha Hyroxysteroid D 7e-06
1q5m_A322 Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh 7e-06
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 1e-05
1a80_A277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 1e-05
1hw6_A278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 1e-05
2fvl_A324 Crystal Structure Of Human 3-alpha Hydroxysteroid/d 1e-05
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 1e-05
1frb_A315 Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 2e-05
1ah0_A316 Pig Aldose Reductase Complexed With Sorbinil Length 7e-05
1c9w_A315 Cho Reductase With Nadp+ Length = 315 7e-05
1dla_A314 Novel Nadph-Binding Domain Revealed By The Crystal 7e-05
1eko_A315 Pig Aldose Reductase Complexed With Idd384 Inhibito 7e-05
3uwe_A331 Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length 8e-05
3r43_A331 Akr1c3 Complexed With Mefenamic Acid Length = 331 8e-05
1s1p_A331 Crystal Structures Of Prostaglandin D2 11-Ketoreduc 8e-05
1ry0_A323 Structure Of Prostaglandin F Synthase With Prostagl 9e-05
3rx2_A336 Crystal Structure Of Human Aldose Reductase Complex 1e-04
1ral_A308 Three-Dimensional Structure Of Rat Liver 3alpha- Hy 1e-04
1z3n_A319 Human Aldose Reductase In Complex With Nadp+ And Th 1e-04
3lqg_A316 Human Aldose Reductase Mutant T113a Complexed With 2e-04
3lbo_A316 Human Aldose Reductase Mutant T113c Complexed With 2e-04
2r24_A316 Human Aldose Reductase Structure Length = 316 2e-04
1ef3_A315 Fidarestat Bound To Human Aldose Reductase Length = 2e-04
3onb_A315 Bond Breakage And Relocation Of A Covalently Bound 2e-04
2acu_A315 Tyrosine-48 Is The Proton Donor And Histidine-110 D 2e-04
1el3_A316 Human Aldose Reductase Complexed With Idd384 Inhibi 2e-04
2is7_A315 Crystal Structure Of Aldose Reductase Complexed Wit 2e-04
3lz5_A316 Human Aldose Reductase Mutant T113v Complexed With 2e-04
3ld5_A316 Human Aldose Reductase Mutant T113s Complexed With 2e-04
1lwi_A322 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO 2e-04
2pdm_A316 Human Aldose Reductase Mutant S302r Complexed With 2e-04
1afs_A323 Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr 2e-04
1pwl_A316 Crystal Structure Of Human Aldose Reductase Complex 2e-04
2pd5_A316 Human Aldose Reductase Mutant V47i Complexed With Z 2e-04
2pdb_A316 Human Aldose Reductase Mutant F121p Complexed With 2e-04
2pdx_A316 Human Aldose Reductase Double Mutant S302r-C303d Co 2e-04
2pdk_A316 Human Aldose Reductase Mutant L301m Complexed With 2e-04
2pdq_A316 Human Aldose Reductase Mutant C303d Complexed With 2e-04
2ipj_A321 Crystal Structure Of H3alpha-Hydroxysteroid Dehydro 2e-04
1ihi_A323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 3e-04
2agt_A319 Aldose Reductase Mutant Leu 300 Pro Complexed With 3e-04
1j96_A323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 3e-04
1xjb_A325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 3e-04
1mrq_A323 Crystal Structure Of Human 20alpha-hsd In Ternary C 3e-04
3c3u_A323 Crystal Structure Of Akr1c1 In Complex With Nadp An 3e-04
2pdi_A316 Human Aldose Reductase Mutant L300a Complexed With 3e-04
3gug_A323 Crystal Structure Of Akr1c1 L308v Mutant In Complex 3e-04
2pdf_A316 Human Aldose Reductase Mutant L300p Complexed With 3e-04
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 3e-04
1m9h_A278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 4e-04
2ipg_A319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 7e-04
2ipf_A318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 7e-04
2he5_A323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 7e-04
3fjn_A323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 8e-04
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 34/49 (69%)
Query: 7   ILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQR 55
           ILR  +Q G + IPKS    RI EN ++FDF L Q D+DKIDAL+K +R
Sbjct: 217 ILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALNKDER 265
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 Back     alignment and structure
>pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 Back     alignment and structure
>pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 Back     alignment and structure
>pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 Back     alignment and structure
>pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 Back     alignment and structure
>pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 Back     alignment and structure
>pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 Back     alignment and structure
>pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 Back     alignment and structure
>pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 Back     alignment and structure
>pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 Back     alignment and structure
>pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 Back     alignment and structure
>pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 Back     alignment and structure
>pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 Back     alignment and structure
>pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 Back     alignment and structure
>pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 Back     alignment and structure
>pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 Back     alignment and structure
>pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 Back     alignment and structure
>pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 Back     alignment and structure
>pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 Back     alignment and structure
>pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 Back     alignment and structure
>pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 Back     alignment and structure
>pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 Back     alignment and structure
>pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 Back     alignment and structure
>pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 Back     alignment and structure
>pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 Back     alignment and structure
>pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 4e-20
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 1e-19
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 1e-19
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 1e-19
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 1e-19
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 1e-19
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 1e-19
4gie_A290 Prostaglandin F synthase; structural genomics, nia 2e-19
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 2e-19
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 2e-19
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 2e-19
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 2e-19
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 4e-19
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 4e-19
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 4e-19
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 4e-19
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 7e-19
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 2e-18
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 2e-18
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 4e-18
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 3e-17
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 4e-17
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 5e-17
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-16
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 3e-15
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 8e-05
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 6e-04
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
 Score = 79.5 bits (197), Expect = 4e-20
 Identities = 19/54 (35%), Positives = 28/54 (51%)

Query: 7   ILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCVMA 60
           +LR  +  G   +PKS    RI EN  VFDF+L + D+ K++     QR  +  
Sbjct: 249 LLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKLEESKNSQRLFLQD 302
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
4gie_A290 Prostaglandin F synthase; structural genomics, nia 99.77
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 99.77
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 99.77
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 99.72
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 99.72
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 99.71
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 99.7
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 99.69
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 99.69
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 99.69
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 99.69
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 99.68
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 99.68
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 99.66
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 99.66
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 99.66
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 99.66
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 99.66
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 99.65
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 99.63
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 99.63
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 99.62
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 99.6
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 99.59
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 99.58
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 99.57
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 99.57
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 99.56
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 99.56
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 99.54
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 99.54
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 99.53
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 99.53
3erp_A353 Putative oxidoreductase; funded by the national in 99.52
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 99.5
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 99.48
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 99.44
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 99.41
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 99.36
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 99.2
4e2i_278 DNA polymerase alpha subunit B; replication initia 87.84
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
Probab=99.77  E-value=1.4e-18  Score=108.36  Aligned_cols=57  Identities=35%  Similarity=0.590  Sum_probs=54.9

Q ss_pred             CCHHHHHHHHHHhCCCeEecCCCCHHHHHHhHhccCCCCCHHHHHHHHhhhcCCccc
Q psy15066          1 MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSC   57 (62)
Q Consensus         1 ~s~aqval~W~l~~~~~~I~g~~~~~~l~~n~~~~~~~L~~e~~~~l~~~~~~~r~~   57 (62)
                      +|++|+||+|++++++++|||+++++|+++|+++++++|++||+++|+++.++.|++
T Consensus       222 ~t~aqvaL~w~l~~~~v~I~G~~~~~~l~eNl~a~~~~Ls~ee~~~ld~l~~~~r~~  278 (290)
T 4gie_A          222 KSPAQVVIRWDIQHGIVTIPKSTNKGRIQENFNVWDFKLTEEEMRQIDELNEDKRIG  278 (290)
T ss_dssp             CCHHHHHHHHHHHTTCEECCBCCSHHHHHHHHCCSSCCCCHHHHHHHHTTCCCCCCS
T ss_pred             CCHHHHHHHHHHhCCCEEEECCCCHHHHHHHHhhcCCCCCHHHHHHHhccCCCCCcC
Confidence            589999999999999999999999999999999999999999999999999999875
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>4e2i_2 DNA polymerase alpha subunit B; replication initiation, hydrolase-DNA binding complex, hydro binding protein complex; HET: DNA; 5.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 62
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 1e-14
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 3e-14
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 4e-14
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 5e-14
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 6e-14
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-13
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 2e-13
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 3e-13
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 3e-13
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 7e-12
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 1e-09
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 1e-09
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 2e-09
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 1e-08
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 1e-06
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 4e-06
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: FR-1 (fibroblast growth factor-induced) protein
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 63.4 bits (153), Expect = 1e-14
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 3   MTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCVM 59
               ++R  +Q   + IPKS T  RI ENI VFDF L   ++  I + ++  R+C++
Sbjct: 244 SAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATILSFNRNWRACLL 300
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 324 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 99.74
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 99.72
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 99.72
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 99.72
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 99.7
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 99.69
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 99.68
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 99.67
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 99.62
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 99.61
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 99.54
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 99.54
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 99.49
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 99.47
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 99.47
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 99.29
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 81.94
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: FR-1 (fibroblast growth factor-induced) protein
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.74  E-value=2.7e-18  Score=105.31  Aligned_cols=58  Identities=34%  Similarity=0.598  Sum_probs=55.6

Q ss_pred             CCHHHHHHHHHHhCCCeEecCCCCHHHHHHhHhccCCCCCHHHHHHHHhhhcCCcccc
Q psy15066          1 MFMTSFILRPQVQSGTIPIPKSNTVKRITENINVFDFTLEQSDVDKIDALDKKQRSCV   58 (62)
Q Consensus         1 ~s~aqval~W~l~~~~~~I~g~~~~~~l~~n~~~~~~~L~~e~~~~l~~~~~~~r~~~   58 (62)
                      +|++|+||+|+++++++||||+++++|+++|+++.+++|++||+++|+++.+++|+|.
T Consensus       242 ~s~aqvALaw~l~~~~vvI~G~~~~~ql~en~~a~~~~Lt~ee~~~l~~l~~~~R~~~  299 (315)
T d1frba_         242 KTSAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATILSFNRNWRACL  299 (315)
T ss_dssp             CCHHHHHHHHHHTTTCEECCBCSCHHHHHHHHCCSSCCCCHHHHHHHHTTCCCCCSCC
T ss_pred             CCHHHHHHHHHHHCCCEEEECCCCHHHHHHHHhhCCCCCCHHHHHHHhccCCCCCcCC
Confidence            5899999999999999999999999999999999999999999999999999999884
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure