Diaphorina citri psyllid: psy15070


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
NNSLGEIDPFNGSKLNGVYFPDEVLEVILVHMEIRTLLASRRVCKKWKSLIETQVLKERAILEGFTRGLTNEDKMNVEWTTWYLMLSPNSLFNRNLVKNPCGQDKFNSWEILNNGGNGWKVETPPFGLSQEAQPLPDDTIPSYWTKITKDSKKATSSTNTESCFVTSYGRCSKQQWIDLGKRKTMLDVIERLNPAIVYSEWFCRRFDCGGRYDLRVALLNEAKKLLAYHIHHTDIGENFKWQKVENKFENYPSGVRYILFIHEGVDSQFWQGHYGPKMTRATVFLIPPGQSYSIRTDGNLPIQSDYIK
cccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHcccccccccccccccccccccccccccEEccccccCEECccccccccccccccccccccccccccccccccccccccccEEEEECccEEEEEEEccccccccHHHHHHccccEEEEEEECcccccccEEEEEEEEEcccccEEEEEEccccccccccEEEEEEEEEccccccEEEEEEEEEECccccccccccEEcccEEEEEcccccccccccccccccccccc
***********GSKLNGVYFPDEVLEVILVHMEIRTLLASRRVCKKWKSLIETQVLKERAILEGFTRGLTNEDKMNVEWTTWYLMLSPNSLFNRNLVKNPCGQDKFNSWEILNNGGNGWKVETPPFGL************PSYWTKITKDSKKATSSTNTESCFVTSYGRCSKQQWIDLGKRKTMLDVIERLNPAIVYSEWFCRRFDCGGRYDLRVALLNEAKKLLAYHIHHTDIGENFKWQKVENKFENYPSGVRYILFIHEGVDSQFWQGHYGPKMTRATVFLIPPG*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NNSLGEIDPFNGSKLNGVYFPDEVLEVILVHMEIRTLLASRRVCKKWKSLIETQVLKERAILEGFTRGLTNEDKMNVEWTTWYLMLSPNSLFNRNLVKNPCGQDKFNSWEILNNGGNGWKVETPPFGLSQEAQPLPDDTIPSYWTKITKDSKKATSSTNTESCFVTSYGRCSKQQWIDLGKRKTMLDVIERLNPAIVYSEWFCRRFDCGGRYDLRVALLNEAKKLLAYHIHHTDIGENFKWQKVENKFENYPSGVRYILFIHEGVDSQFWQGHYGPKMTRATVFLIPPGQSYSIRTDGNLPIQSDYIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box only protein 44 Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.confidentQ9H4M3
F-box only protein 6 Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complexes. Involved in endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranlocated into the cytosol and promoting their ubiquitination and subsequent degradation. Able to recognize and bind denatured glycoproteins, which are modified with not only high-mannose but also complex-type oligosaccharides. Also recognizes sulfated glycans. Also involved in DNA damage response by specifically recognizing activated CHEK1 (phosphorylated on 'Ser-345'), promoting its ubiquitination and degradation. Ubiquitination of CHEK1 is required to insure that activated CHEK1 does not accumulate as cells progress through S phase, or when replication forks encounter transient impediments during normal DNA replication.confidentQ3SX24
F-box only protein 6 Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complexes. Involved in endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranlocated into the cytosol and promoting their ubiquitination and subsequent degradation. Able to recognize and bind denatured glycoproteins, which are modified with not only high-mannose but also complex-type oligosaccharides. Also recognizes sulfated glycans. Also involved in DNA damage response by specifically recognizing activated CHEK1 (phosphorylated on 'Ser-345'), promoting its ubiquitination and degradation. Ubiquitination of CHEK1 is required to insure that activated CHEK1 does not accumulate as cells progress through S phase, or when replication forks encounter transient impediments during normal DNA replication.confidentQ923V4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030163 [BP]protein catabolic processprobableGO:0044238, GO:1901575, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0044265 [BP]cellular macromolecule catabolic processprobableGO:1901575, GO:0044260, GO:0009987, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0001948 [MF]glycoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0019005 [CC]SCF ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E31, chain A
Confidence level:very confident
Coverage over the Query: 35-140,161-287
View the alignment between query and template
View the model in PyMOL