Diaphorina citri psyllid: psy15075

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39

NDSWTSGSICSQLNPDVLKNIKDCFPDLQTQVKLKLLLSFFHIPRRNMDEWKVELEEILEVATVDTEQWVSMVAELMKTYPATMSLNTEIGDQDPYLIEAVGFNGGGTHEDLSRHHWKVELEEILEVATVDTEQWVSMVAELMKTYPATMSLNTEIGEIVENKRIFSDLINDLRKLVKRQGSESSSYSSGSNNSQMLPLECQYLNKSALISVVGQQSSVIKHFTLKRKPKSAALRAELVQKSMDAASNMKKAAAPTVPVRSRGMPRKMTDTTPLKGIPSRVPSGGFRSPTLSSSLSRPIMSIPRNPAGRKDGGIKLLDITEQPLGYAQAKKKKKQENPCPTYGNVVTIKLSESQEIHPLGDPVLVEHHFQMNYNTGEWKKIKKVKTLVS

ccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHcccccccccEEEEEccccccccccccccEEEEEEEEccccccCEEEEccccccc

******GSICSQLNPDVLKNIKDCFPDLQTQVKLKLLLSFFHIPRRNMDEWKVELEEILEVATVDTEQWVSMVAELMKTYPATMSLNTEIGDQDPYLIEAVGFNGGGTHEDLSRHHWKVELEEILEVATVDTEQWVSMVAELMKTYPATMSLNTEIGEIVENKRIFSDLINDLRKLVK*****************MLPLECQYLNKSALISVVGQQSSVIKHFTLKR******************************************************************************************DITE*******************TYGNVVTIKLSESQEIHPLGDPVLVEHHFQMNYNTGEWKKIKKVKT***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Negative elongation factor A	Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. Has an essential role in postembryonic development.	confident	Q86NP2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0034244 [BP]	negative regulation of transcription elongation from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0034243, GO:0045934, GO:0019219, GO:0032784, GO:0009889, GO:0032785, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted