Diaphorina citri psyllid: psy15098


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MDQGQLTGLECYWDIKYLDYLPTNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFNVTGHRTEND
ccccccccCEEEEEcccccccccHHHHHHHHHHcccccccEEEEHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcEEEEEEEECccccc
****QLTGLECYWDIKYLDYLPTNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFNVT*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQGQLTGLECYWDIKYLDYLPTNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFNVTGHRTEND

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048060 [BP]negative gravitaxisprobableGO:0009629, GO:0009628, GO:0042332, GO:0042330, GO:0009605, GO:0050896, GO:0008150, GO:0040011
GO:0006821 [BP]chloride transportprobableGO:0006811, GO:0006810, GO:0006820, GO:0044765, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0008289 [MF]lipid bindingprobableGO:0003674, GO:0005488
GO:0097305 [BP]response to alcoholprobableGO:1901700, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YV7, chain A
Confidence level:very confident
Coverage over the Query: 23-76
View the alignment between query and template
View the model in PyMOL