Psyllid ID: psy15098
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 92 | ||||||
| 242008996 | 240 | Chloride intracellular channel exl-1, pu | 0.434 | 0.166 | 0.76 | 5e-13 | |
| 195352478 | 261 | GM17583 [Drosophila sechellia] gi|195566 | 0.413 | 0.145 | 0.791 | 5e-13 | |
| 195478444 | 261 | GE16136 [Drosophila yakuba] gi|194188044 | 0.413 | 0.145 | 0.791 | 5e-13 | |
| 194895286 | 261 | GG19483 [Drosophila erecta] gi|190649870 | 0.413 | 0.145 | 0.791 | 5e-13 | |
| 195167158 | 263 | GL15013 [Drosophila persimilis] gi|19846 | 0.413 | 0.144 | 0.791 | 5e-13 | |
| 195059275 | 263 | GH17841 [Drosophila grimshawi] gi|193896 | 0.413 | 0.144 | 0.791 | 5e-13 | |
| 18859677 | 260 | chloride intracellular channel, isoform | 0.413 | 0.146 | 0.791 | 5e-13 | |
| 195132791 | 263 | GI21754 [Drosophila mojavensis] gi|19390 | 0.413 | 0.144 | 0.791 | 6e-13 | |
| 194769412 | 261 | GF19090 [Drosophila ananassae] gi|190618 | 0.413 | 0.145 | 0.791 | 6e-13 | |
| 289739975 | 257 | chloride intracellular channel [Glossina | 0.413 | 0.147 | 0.791 | 6e-13 |
| >gi|242008996|ref|XP_002425279.1| Chloride intracellular channel exl-1, putative [Pediculus humanus corporis] gi|212509044|gb|EEB12541.1| Chloride intracellular channel exl-1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 78.6 bits (192), Expect = 5e-13, Method: Compositional matrix adjust.
Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 10/50 (20%)
Query: 29 RLASTIDGRRKGACLFCQEYFMDL----------LKVTTVDMQKPPPDFR 68
++ASTIDGRRKGACLFCQEYFMDL LKVTTVDMQKPPPDFR
Sbjct: 5 KVASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFR 54
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195352478|ref|XP_002042739.1| GM17583 [Drosophila sechellia] gi|195566648|ref|XP_002106891.1| GD15871 [Drosophila simulans] gi|194126770|gb|EDW48813.1| GM17583 [Drosophila sechellia] gi|194204284|gb|EDX17860.1| GD15871 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|195478444|ref|XP_002100520.1| GE16136 [Drosophila yakuba] gi|194188044|gb|EDX01628.1| GE16136 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194895286|ref|XP_001978221.1| GG19483 [Drosophila erecta] gi|190649870|gb|EDV47148.1| GG19483 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195167158|ref|XP_002024401.1| GL15013 [Drosophila persimilis] gi|198469067|ref|XP_001354897.2| GA10697 [Drosophila pseudoobscura pseudoobscura] gi|194107774|gb|EDW29817.1| GL15013 [Drosophila persimilis] gi|198146701|gb|EAL31953.2| GA10697 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195059275|ref|XP_001995601.1| GH17841 [Drosophila grimshawi] gi|193896387|gb|EDV95253.1| GH17841 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|18859677|ref|NP_572928.1| chloride intracellular channel, isoform A [Drosophila melanogaster] gi|168177177|pdb|2YV7|A Chain A, Crystal Structure Of The Clic Homolog From Drosophila Melanogaster gi|7292935|gb|AAF48326.1| chloride intracellular channel, isoform A [Drosophila melanogaster] gi|16185715|gb|AAL13950.1| LD46306p [Drosophila melanogaster] gi|220946362|gb|ACL85724.1| Clic-PA [synthetic construct] gi|220956060|gb|ACL90573.1| Clic-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195132791|ref|XP_002010826.1| GI21754 [Drosophila mojavensis] gi|193907614|gb|EDW06481.1| GI21754 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|194769412|ref|XP_001966798.1| GF19090 [Drosophila ananassae] gi|190618319|gb|EDV33843.1| GF19090 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|289739975|gb|ADD18735.1| chloride intracellular channel [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 92 | ||||||
| FB|FBgn0030529 | 260 | Clic "Chloride intracellular c | 0.413 | 0.146 | 0.791 | 7.9e-14 |
| FB|FBgn0030529 Clic "Chloride intracellular channel" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 179 (68.1 bits), Expect = 7.9e-14, P = 7.9e-14
Identities = 38/48 (79%), Positives = 38/48 (79%)
Query: 31 ASTIDGRRKGACLFCQEYFMDL----------LKVTTVDMQKPPPDFR 68
ASTIDGRRKGACLFCQEYFMDL LKVTTVDMQKPPPDFR
Sbjct: 29 ASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFR 76
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.324 0.141 0.455 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 92 92 0.00091 102 3 11 22 0.47 29
29 0.40 31
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 556 (59 KB)
Total size of DFA: 124 KB (2080 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 10.79u 0.08s 10.87t Elapsed: 00:00:06
Total cpu time: 10.79u 0.09s 10.88t Elapsed: 00:00:06
Start: Thu Aug 15 11:12:18 2013 End: Thu Aug 15 11:12:24 2013
|
|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 92 | |||
| cd03061 | 91 | cd03061, GST_N_CLIC, GST_N family, Chloride Intrac | 3e-14 | |
| TIGR00862 | 236 | TIGR00862, O-ClC, intracellular chloride channel p | 3e-04 |
| >gnl|CDD|239359 cd03061, GST_N_CLIC, GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
Score = 61.6 bits (150), Expect = 3e-14
Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 6/44 (13%)
Query: 35 DGRRKGACLFCQEYFMDL------LKVTTVDMQKPPPDFRDLYL 72
DG G C FCQ FM L VTTVDM++ P D +DL
Sbjct: 15 DGESIGNCPFCQRLFMVLWLKGVVFNVTTVDMKRKPEDLKDLAP 58
|
They are auto-inserting, self-assembling intracellular anion channels involved in a wide variety of functions including regulated secretion, cell division and apoptosis. They can exist in both water-soluble and membrane-bound states, and are found in various vesicles and membranes. Biochemical studies of the C. elegans homolog, EXC-4, show that the membrane localization domain is present in the N-terminal part of the protein. The structure of soluble human CLIC1 reveals that it is monomeric and it adopts a fold similar to GSTs, containing an N-terminal domain with a TRX fold and a C-terminal alpha helical domain. Upon oxidation, the N-terminal domain of CLIC1 undergoes a structural change to form a non-covalent dimer stabilized by the formation of an intramolecular disulfide bond between two cysteines that are far apart in the reduced form. The CLIC1 dimer bears no similarity to GST dimers. The redox-controlled structural rearrangement exposes a large hydrophobic surface, which is masked by dimerization in vitro. In vivo, this surface may represent the docking interface of CLIC1 in its membrane-bound state. The two cysteines in CLIC1 that form the disulfide bond in oxidizing conditions are essential for dimerization and chloride channel activity, however, in other subfamily members, the second cysteine is not conserved. Length = 91 |
| >gnl|CDD|129941 TIGR00862, O-ClC, intracellular chloride channel protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| KOG1422|consensus | 221 | 99.78 | ||
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 99.55 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 99.29 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 98.81 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 98.65 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 97.7 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 97.43 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 97.41 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 97.19 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 96.97 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 96.76 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 96.65 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 96.63 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 96.57 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 96.52 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 96.5 | |
| KOG0406|consensus | 231 | 96.48 | ||
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 96.47 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 96.33 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 95.81 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 95.71 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 95.58 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 95.57 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 95.23 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 95.04 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 94.91 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 94.65 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 94.61 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 94.53 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 93.99 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 93.94 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 93.23 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 93.11 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 93.02 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 92.8 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 92.38 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 91.64 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 91.63 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 91.45 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 91.08 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 90.81 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 90.79 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 90.63 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 89.81 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 89.15 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 88.88 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 87.95 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 87.87 | |
| PLN02473 | 214 | glutathione S-transferase | 87.85 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 87.6 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 87.27 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 86.68 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 86.32 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 86.04 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 85.89 | |
| PF04134 | 114 | DUF393: Protein of unknown function, DUF393; Inter | 85.16 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 85.13 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 85.05 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 84.75 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 84.13 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 83.45 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 83.42 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 82.81 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 81.73 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 81.2 |
| >KOG1422|consensus | Back alignment and domain information |
|---|
Probab=99.78 E-value=1.8e-19 Score=139.34 Aligned_cols=52 Identities=38% Similarity=0.613 Sum_probs=50.4
Q ss_pred CeeEEEeecCCC-ccccCCchhHHHhhhe------eeeeEeeCCCCChhHHhhccCCcc
Q psy15098 25 KLKERLASTIDG-RRKGACLFCQEYFMDL------LKVTTVDMQKPPPDFRDLYLLKKT 76 (92)
Q Consensus 25 ~i~lvvKAgsDg-~~lG~CPFcQRlFMiL------f~VTTVD~krKP~~f~dL~p~g~~ 76 (92)
.|+++||||+++ +++|+||||||+||+| |+|||||++|||+||++++|+|++
T Consensus 3 ~iel~vkA~s~~~~~~Gdcpf~qr~~m~L~~k~~~f~vttVd~~~kp~~f~~~sp~~~~ 61 (221)
T KOG1422|consen 3 EIELCVKAGSDGPDSLGDCPFCQRLFMTLELKGVPFKVTTVDLSRKPEWFLDISPGGKP 61 (221)
T ss_pred ceEEEEEeccCCcccCCCChhHHHHHHHHHHcCCCceEEEeecCCCcHHHHhhCCCCCC
Confidence 589999999999 9999999999999999 999999999999999999999986
|
|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 92 | ||||
| 2yv7_A | 260 | Crystal Structure Of The Clic Homolog From Drosophi | 1e-15 |
| >pdb|2YV7|A Chain A, Crystal Structure Of The Clic Homolog From Drosophila Melanogaster Length = 260 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 92 | |||
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 9e-08 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 5e-07 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 1e-06 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 2e-05 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 3e-05 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 7e-05 |
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
Score = 46.6 bits (110), Expect = 9e-08
Identities = 37/55 (67%), Positives = 38/55 (69%), Gaps = 10/55 (18%)
Query: 31 ASTIDGRRKGACLFCQEYFMDLL----------KVTTVDMQKPPPDFRDLYLLKK 75
ASTIDGRRKGACLFCQEYFMDL KVTTVDMQKPPPDFR +
Sbjct: 29 ASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATH 83
|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 98.96 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 98.66 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 98.58 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 98.51 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 98.49 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 98.45 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 97.76 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 97.31 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 96.89 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 96.71 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 96.67 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 96.41 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 96.38 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 96.29 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 96.25 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 96.21 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 96.17 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 96.15 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 96.13 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 96.06 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 95.93 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 95.91 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 95.65 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 95.65 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 95.59 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 95.58 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 95.52 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 95.49 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 95.35 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 95.34 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 95.18 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 95.18 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 95.06 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 95.06 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 94.94 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 94.93 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 94.9 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 94.89 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 94.87 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 94.86 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 94.81 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 94.74 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 94.69 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 94.69 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 94.65 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 94.59 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 94.55 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 94.53 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 94.35 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 94.28 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 94.27 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 94.24 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 94.09 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 94.05 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 93.98 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 93.96 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 93.92 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 93.8 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 93.64 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 93.53 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 93.47 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 93.43 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 93.29 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 92.8 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 92.78 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 92.71 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 92.63 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 92.56 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 92.56 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 92.51 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 92.47 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 92.42 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 92.36 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 92.25 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 92.12 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 92.09 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 92.06 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 91.99 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 91.78 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 91.76 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 91.71 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 91.24 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 91.17 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 90.86 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 90.85 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 90.79 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 90.64 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 90.54 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 90.5 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 90.45 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 90.44 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 90.09 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 89.89 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 89.52 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 89.36 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 88.95 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 88.95 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 88.91 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 88.59 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 88.31 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 88.24 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 87.62 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 87.57 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 87.29 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 87.07 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 87.0 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 86.93 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 86.77 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 86.6 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 86.39 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 86.27 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 85.83 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 85.51 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 85.29 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 85.23 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 85.21 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 85.18 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 85.04 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 84.63 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 84.56 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 84.5 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 83.88 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 82.33 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 82.15 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 81.69 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 80.77 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 80.3 |
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
Probab=98.96 E-value=3.9e-10 Score=80.03 Aligned_cols=54 Identities=31% Similarity=0.502 Sum_probs=35.8
Q ss_pred CCCeeEEEeecCCCccccCCchhHHHhhhe------eeeeEeeCCCCChhHHhhccCCcc
Q psy15098 23 TNKLKERLASTIDGRRKGACLFCQEYFMDL------LKVTTVDMQKPPPDFRDLYLLKKT 76 (92)
Q Consensus 23 ~~~i~lvvKAgsDg~~lG~CPFcQRlFMiL------f~VTTVD~krKP~~f~dL~p~g~~ 76 (92)
..+|+|++||++|+.+.+.||||+|+.|+| |.+..||+..+|++|++++|.++.
T Consensus 23 ~~~i~l~~ka~~~~~s~~~sP~~~rv~~~L~~~gi~ye~~~v~~~~~~~~~~~~nP~g~V 82 (250)
T 3fy7_A 23 ETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQL 82 (250)
T ss_dssp --CEEEEEEBCTTSSSBCSCHHHHHHHHHHHHHTCCCEEEEEC--------------CCS
T ss_pred CCCceEEEEeCCCCCCCCCChHHHHHHHHHHHcCCccEEEECCCccChHHHHhhCCCCCC
Confidence 467999999999999999999999999999 999999999999999999998864
|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 99.59 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 98.17 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 97.55 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 97.39 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 97.23 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 96.7 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 96.61 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 96.4 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 96.28 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 96.21 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 96.02 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 96.0 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 95.85 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 95.53 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 95.41 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 94.77 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 93.62 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 92.74 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 91.84 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 86.3 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 86.23 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 85.25 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 84.23 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 83.08 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 80.56 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 80.21 |
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Glutathione S-transferase (GST), N-terminal domain domain: Chloride intracellular channel 1 (clic1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.59 E-value=6e-16 Score=98.39 Aligned_cols=52 Identities=29% Similarity=0.429 Sum_probs=49.3
Q ss_pred CeeEEEeecCCCccccCCchhHHHhhhe------eeeeEeeCCCCChhHHhhccCCcc
Q psy15098 25 KLKERLASTIDGRRKGACLFCQEYFMDL------LKVTTVDMQKPPPDFRDLYLLKKT 76 (92)
Q Consensus 25 ~i~lvvKAgsDg~~lG~CPFcQRlFMiL------f~VTTVD~krKP~~f~dL~p~g~~ 76 (92)
.|++++||++||+++|+||||||+.|+| |++..||+.++|++|++++|.++.
T Consensus 2 ~i~l~~ka~~dg~~~~~cPf~~rv~~~L~~kgi~~~~~~v~~~~~~~~~~~~nP~~~v 59 (86)
T d1k0ma2 2 QVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGEL 59 (86)
T ss_dssp CEEEEEEBCTTSSSBCSCHHHHHHHHHHHHHTCCCEEEEECTTSCCHHHHHHCTTCCS
T ss_pred cEEEEEecCCCcCcCCCCHhHHHHHHHHHHHCCCcEEEEeecccccHHHHHHhccCce
Confidence 5899999999999999999999999999 999999999999999999998764
|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|