Psyllid ID: psy15098


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MDQGQLTGLECYWDIKYLDYLPTNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFNVTGHRTEND
ccccccccEEEEEEcccccccccHHHHHHHHHHcccccccEEEEHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcEEEEEEEEEccccc
cccccccccEEEEEHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHEEccccccccHHHHHHHHHHHHHHcccccccccccc
mdqgqltglecywdikyldylptnklKERLASTIDGRRKGACLFCQEYFMDLLKVTTvdmqkpppdfrdLYLLKKTFWQLNfnvtghrtend
mdqgqltglecywdikyldylptNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWqlnfnvtghrtend
MDQGQLTGLECYWDIKYLDYLPTNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFNVTGHRTEND
*****LTGLECYWDIKYLDYLPTNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFNVT*******
****QLT*LECYWDIKYLDYLPTNKLKERLAS*IDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFN*********
MDQGQLTGLECYWDIKYLDYLPTNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFNVTGHRTEND
*****LTGLECYWDIKYLDYLPTNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFNVT*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQGQLTGLECYWDIKYLDYLPTNKLKERLASTIDGRRKGACLFCQEYFMDLLKVTTVDMQKPPPDFRDLYLLKKTFWQLNFNVTGHRTEND
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
242008996 240 Chloride intracellular channel exl-1, pu 0.434 0.166 0.76 5e-13
195352478 261 GM17583 [Drosophila sechellia] gi|195566 0.413 0.145 0.791 5e-13
195478444 261 GE16136 [Drosophila yakuba] gi|194188044 0.413 0.145 0.791 5e-13
194895286 261 GG19483 [Drosophila erecta] gi|190649870 0.413 0.145 0.791 5e-13
195167158 263 GL15013 [Drosophila persimilis] gi|19846 0.413 0.144 0.791 5e-13
195059275 263 GH17841 [Drosophila grimshawi] gi|193896 0.413 0.144 0.791 5e-13
18859677 260 chloride intracellular channel, isoform 0.413 0.146 0.791 5e-13
195132791 263 GI21754 [Drosophila mojavensis] gi|19390 0.413 0.144 0.791 6e-13
194769412 261 GF19090 [Drosophila ananassae] gi|190618 0.413 0.145 0.791 6e-13
289739975 257 chloride intracellular channel [Glossina 0.413 0.147 0.791 6e-13
>gi|242008996|ref|XP_002425279.1| Chloride intracellular channel exl-1, putative [Pediculus humanus corporis] gi|212509044|gb|EEB12541.1| Chloride intracellular channel exl-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 10/50 (20%)

Query: 29 RLASTIDGRRKGACLFCQEYFMDL----------LKVTTVDMQKPPPDFR 68
          ++ASTIDGRRKGACLFCQEYFMDL          LKVTTVDMQKPPPDFR
Sbjct: 5  KVASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFR 54




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195352478|ref|XP_002042739.1| GM17583 [Drosophila sechellia] gi|195566648|ref|XP_002106891.1| GD15871 [Drosophila simulans] gi|194126770|gb|EDW48813.1| GM17583 [Drosophila sechellia] gi|194204284|gb|EDX17860.1| GD15871 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195478444|ref|XP_002100520.1| GE16136 [Drosophila yakuba] gi|194188044|gb|EDX01628.1| GE16136 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194895286|ref|XP_001978221.1| GG19483 [Drosophila erecta] gi|190649870|gb|EDV47148.1| GG19483 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195167158|ref|XP_002024401.1| GL15013 [Drosophila persimilis] gi|198469067|ref|XP_001354897.2| GA10697 [Drosophila pseudoobscura pseudoobscura] gi|194107774|gb|EDW29817.1| GL15013 [Drosophila persimilis] gi|198146701|gb|EAL31953.2| GA10697 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195059275|ref|XP_001995601.1| GH17841 [Drosophila grimshawi] gi|193896387|gb|EDV95253.1| GH17841 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|18859677|ref|NP_572928.1| chloride intracellular channel, isoform A [Drosophila melanogaster] gi|168177177|pdb|2YV7|A Chain A, Crystal Structure Of The Clic Homolog From Drosophila Melanogaster gi|7292935|gb|AAF48326.1| chloride intracellular channel, isoform A [Drosophila melanogaster] gi|16185715|gb|AAL13950.1| LD46306p [Drosophila melanogaster] gi|220946362|gb|ACL85724.1| Clic-PA [synthetic construct] gi|220956060|gb|ACL90573.1| Clic-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195132791|ref|XP_002010826.1| GI21754 [Drosophila mojavensis] gi|193907614|gb|EDW06481.1| GI21754 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194769412|ref|XP_001966798.1| GF19090 [Drosophila ananassae] gi|190618319|gb|EDV33843.1| GF19090 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|289739975|gb|ADD18735.1| chloride intracellular channel [Glossina morsitans morsitans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
FB|FBgn0030529 260 Clic "Chloride intracellular c 0.413 0.146 0.791 7.9e-14
FB|FBgn0030529 Clic "Chloride intracellular channel" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 179 (68.1 bits), Expect = 7.9e-14, P = 7.9e-14
 Identities = 38/48 (79%), Positives = 38/48 (79%)

Query:    31 ASTIDGRRKGACLFCQEYFMDL----------LKVTTVDMQKPPPDFR 68
             ASTIDGRRKGACLFCQEYFMDL          LKVTTVDMQKPPPDFR
Sbjct:    29 ASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFR 76


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.324   0.141   0.455    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       92        92   0.00091  102 3  11 22  0.47    29
                                                     29  0.40    31


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  556 (59 KB)
  Total size of DFA:  124 KB (2080 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  10.79u 0.08s 10.87t   Elapsed:  00:00:06
  Total cpu time:  10.79u 0.09s 10.88t   Elapsed:  00:00:06
  Start:  Thu Aug 15 11:12:18 2013   End:  Thu Aug 15 11:12:24 2013


GO:0005254 "chloride channel activity" evidence=ISS;IDA
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0005509 "calcium ion binding" evidence=IDA
GO:0006821 "chloride transport" evidence=IDA
GO:0008289 "lipid binding" evidence=IDA
GO:0097305 "response to alcohol" evidence=IDA
GO:0048060 "negative gravitaxis" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
cd0306191 cd03061, GST_N_CLIC, GST_N family, Chloride Intrac 3e-14
TIGR00862 236 TIGR00862, O-ClC, intracellular chloride channel p 3e-04
>gnl|CDD|239359 cd03061, GST_N_CLIC, GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
 Score = 61.6 bits (150), Expect = 3e-14
 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 35 DGRRKGACLFCQEYFMDL------LKVTTVDMQKPPPDFRDLYL 72
          DG   G C FCQ  FM L        VTTVDM++ P D +DL  
Sbjct: 15 DGESIGNCPFCQRLFMVLWLKGVVFNVTTVDMKRKPEDLKDLAP 58


They are auto-inserting, self-assembling intracellular anion channels involved in a wide variety of functions including regulated secretion, cell division and apoptosis. They can exist in both water-soluble and membrane-bound states, and are found in various vesicles and membranes. Biochemical studies of the C. elegans homolog, EXC-4, show that the membrane localization domain is present in the N-terminal part of the protein. The structure of soluble human CLIC1 reveals that it is monomeric and it adopts a fold similar to GSTs, containing an N-terminal domain with a TRX fold and a C-terminal alpha helical domain. Upon oxidation, the N-terminal domain of CLIC1 undergoes a structural change to form a non-covalent dimer stabilized by the formation of an intramolecular disulfide bond between two cysteines that are far apart in the reduced form. The CLIC1 dimer bears no similarity to GST dimers. The redox-controlled structural rearrangement exposes a large hydrophobic surface, which is masked by dimerization in vitro. In vivo, this surface may represent the docking interface of CLIC1 in its membrane-bound state. The two cysteines in CLIC1 that form the disulfide bond in oxidizing conditions are essential for dimerization and chloride channel activity, however, in other subfamily members, the second cysteine is not conserved. Length = 91

>gnl|CDD|129941 TIGR00862, O-ClC, intracellular chloride channel protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 92
KOG1422|consensus 221 99.78
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.55
TIGR00862 236 O-ClC intracellular chloride channel protein. Thes 99.29
PLN02378 213 glutathione S-transferase DHAR1 98.81
PLN02817 265 glutathione dehydrogenase (ascorbate) 98.65
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 97.7
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 97.43
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 97.41
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 97.19
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 96.97
PRK09481 211 sspA stringent starvation protein A; Provisional 96.76
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 96.65
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 96.63
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 96.57
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 96.52
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 96.5
KOG0406|consensus 231 96.48
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 96.47
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 96.33
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 95.81
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 95.71
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 95.58
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 95.57
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 95.23
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 95.04
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 94.91
PRK1063883 glutaredoxin 3; Provisional 94.65
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 94.61
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 94.53
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 93.99
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 93.94
PRK15113 214 glutathione S-transferase; Provisional 93.23
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 93.11
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 93.02
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 92.8
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 92.38
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 91.64
COG0625 211 Gst Glutathione S-transferase [Posttranslational m 91.63
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 91.45
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 91.08
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 90.81
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 90.79
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 90.63
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 89.81
PRK10824115 glutaredoxin-4; Provisional 89.15
TIGR01262 210 maiA maleylacetoacetate isomerase. Maleylacetoacet 88.88
PHA03050108 glutaredoxin; Provisional 87.95
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 87.87
PLN02473 214 glutathione S-transferase 87.85
PRK10357 202 putative glutathione S-transferase; Provisional 87.6
PRK1032981 glutaredoxin-like protein; Provisional 87.27
PRK13972 215 GSH-dependent disulfide bond oxidoreductase; Provi 86.68
TIGR02182 209 GRXB Glutaredoxin, GrxB family. This model include 86.32
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 86.04
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 85.89
PF04134114 DUF393: Protein of unknown function, DUF393; Inter 85.16
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 85.13
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 85.05
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 84.75
PF13728215 TraF: F plasmid transfer operon protein 84.13
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 83.45
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 83.42
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 82.81
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 81.73
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 81.2
>KOG1422|consensus Back     alignment and domain information
Probab=99.78  E-value=1.8e-19  Score=139.34  Aligned_cols=52  Identities=38%  Similarity=0.613  Sum_probs=50.4

Q ss_pred             CeeEEEeecCCC-ccccCCchhHHHhhhe------eeeeEeeCCCCChhHHhhccCCcc
Q psy15098         25 KLKERLASTIDG-RRKGACLFCQEYFMDL------LKVTTVDMQKPPPDFRDLYLLKKT   76 (92)
Q Consensus        25 ~i~lvvKAgsDg-~~lG~CPFcQRlFMiL------f~VTTVD~krKP~~f~dL~p~g~~   76 (92)
                      .|+++||||+++ +++|+||||||+||+|      |+|||||++|||+||++++|+|++
T Consensus         3 ~iel~vkA~s~~~~~~Gdcpf~qr~~m~L~~k~~~f~vttVd~~~kp~~f~~~sp~~~~   61 (221)
T KOG1422|consen    3 EIELCVKAGSDGPDSLGDCPFCQRLFMTLELKGVPFKVTTVDLSRKPEWFLDISPGGKP   61 (221)
T ss_pred             ceEEEEEeccCCcccCCCChhHHHHHHHHHHcCCCceEEEeecCCCcHHHHhhCCCCCC
Confidence            589999999999 9999999999999999      999999999999999999999986



>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
2yv7_A 260 Crystal Structure Of The Clic Homolog From Drosophi 1e-15
>pdb|2YV7|A Chain A, Crystal Structure Of The Clic Homolog From Drosophila Melanogaster Length = 260 Back     alignment and structure

Iteration: 1

Score = 78.2 bits (191), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 38/48 (79%), Positives = 38/48 (79%), Gaps = 10/48 (20%) Query: 31 ASTIDGRRKGACLFCQEYFMDL----------LKVTTVDMQKPPPDFR 68 ASTIDGRRKGACLFCQEYFMDL LKVTTVDMQKPPPDFR Sbjct: 29 ASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFR 76

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 9e-08
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel prote 5e-07
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 1e-06
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 2e-05
2r4v_A 247 XAP121, chloride intracellular channel protein 2; 3e-05
3fy7_A 250 Chloride intracellular channel protein 3; GST, glu 7e-05
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
 Score = 46.6 bits (110), Expect = 9e-08
 Identities = 37/55 (67%), Positives = 38/55 (69%), Gaps = 10/55 (18%)

Query: 31 ASTIDGRRKGACLFCQEYFMDLL----------KVTTVDMQKPPPDFRDLYLLKK 75
          ASTIDGRRKGACLFCQEYFMDL           KVTTVDMQKPPPDFR  +    
Sbjct: 29 ASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATH 83


>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
3fy7_A 250 Chloride intracellular channel protein 3; GST, glu 98.96
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel prote 98.66
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 98.58
2r4v_A 247 XAP121, chloride intracellular channel protein 2; 98.51
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 98.49
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 98.45
4hoj_A 210 REGF protein; GST, glutathione S-transferase, enzy 97.76
4glt_A 225 Glutathione S-transferase-like protein; structural 97.31
3vln_A 241 GSTO-1, glutathione S-transferase omega-1; GST fol 96.89
3q18_A 239 GSTO-2, glutathione S-transferase omega-2; glutath 96.71
3rbt_A 246 Glutathione transferase O1; glutathione S-transfer 96.67
1yy7_A 213 SSPA, stringent starvation protein A; GST fold, tr 96.41
4g10_A 265 Glutathione S-transferase homolog; thioredoxin fol 96.38
1gwc_A 230 Glutathione S-transferase TSI-1; herbicide detoxif 96.29
3lyk_A 216 Stringent starvation protein A homolog; structural 96.25
3r2q_A 202 Uncharacterized GST-like protein YIBF; transferase 96.21
2vo4_A 219 2,4-D inducible glutathione S-transferase; herbici 96.17
4hi7_A 228 GI20122; GST, glutathione S-transferase, enzyme fu 96.15
3m0f_A 213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 96.13
1oyj_A 231 Glutathione S-transferase; herbicide detoxificatio 96.06
3lyp_A 215 Stringent starvation protein A; structural genomic 95.93
4dej_A 231 Glutathione S-transferase related protein; transfe 95.91
4id0_A 214 Glutathione S-transferase-like protein YIBF; GST, 95.65
3tou_A 226 Glutathione S-transferase protein; GSH binding sit 95.65
2v6k_A 214 Maleylpyruvate isomerase; glutathione-S-transferas 95.59
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 95.58
1axd_A 209 Glutathione S-transferase I; transferase, herbicid 95.52
3niv_A 222 Glutathione S-transferase; structural genomics, PS 95.49
1gnw_A 211 Glutathione S-transferase; herbicide detoxificatio 95.35
3f6d_A 219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 95.34
4hz2_A 230 Glutathione S-transferase domain; glutathione,enzy 95.18
3gx0_A 215 GST-like protein YFCG; transferase, glutathione, g 95.18
1yq1_A 208 Glutathione S-transferase; nematoda, structural ge 95.06
1aw9_A 216 Glutathione S-transferase III; herbicide detoxific 95.06
4exj_A 238 Uncharacterized protein; transferase-like protein, 94.94
3ay8_A 216 Glutathione S-transferase; GST fold, GST binding, 94.93
3n5o_A 235 Glutathione transferase; seattle structural genomi 94.9
3bby_A 215 Uncharacterized GST-like protein YFCF; NP_416804.1 94.89
2cz2_A 223 Maleylacetoacetate isomerase; structural genomics, 94.87
3qav_A 243 RHO-class glutathione S-transferase; cytosol; 2.10 94.86
1e6b_A 221 Glutathione S-transferase; 1.65A {Arabidopsis thal 94.81
1ljr_A 244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 94.74
3vk9_A 216 Glutathione S-transferase delta; glutathione bindi 94.69
1pn9_A 209 GST class-delta, glutathione S-transferase 1-6; pr 94.69
2c3n_A 247 Glutathione S-transferase theta 1; glutathione tra 94.65
4iel_A 229 Glutathione S-transferase, N-terminal domain PROT; 94.59
3m8n_A 225 Possible glutathione S-transferase; PSI-II, struct 94.55
1k0d_A 260 URE2 protein; nitrate assimilation, structural gen 94.53
3ein_A 209 GST class-theta, glutathione S-transferase 1-1; de 94.35
4ikh_A 244 Glutathione S-transferase; enzyme function initiat 94.28
3m3m_A 210 Glutathione S-transferase; PSI-II, structural geno 94.27
1r5a_A 218 Glutathione transferase; glutathione S-transferase 94.24
3lxz_A 229 Glutathione S-transferase family protein; structur 94.09
4ecj_A 244 Glutathione S-transferase; transferase-like protei 94.05
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 93.98
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 93.96
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 93.92
2imi_A 221 Epsilon-class glutathione S-transferase; HET: GSH; 93.8
3ppu_A 352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 93.64
4f03_A 253 Glutathione transferase; GST fold; 1.80A {Phaneroc 93.53
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 93.47
3cbu_A 214 Probable GST-related protein; thioredoxin fold, GS 93.43
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 93.29
2ws2_A 204 NU-class GST, glutathione S-transferase; parasite, 92.8
3ibh_A 233 GST-II, saccharomyces cerevisiae GTT2; glutathione 92.78
2on5_A 206 Nagst-2, Na glutathione S-transferase 2; hookworm; 92.71
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 92.63
1f2e_A 201 Glutathione S-transferase; GST complexed with glut 92.56
2cvd_A 198 Glutathione-requiring prostaglandin D synthase; gl 92.56
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 92.51
1nhy_A 219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 92.47
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 92.42
2gsq_A 202 Squid GST, glutathione S-transferase; squid digest 92.36
1v2a_A 210 Glutathione transferase GST1-6; glutathione S-tran 92.25
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 92.12
3m1g_A 362 Putative glutathione S-transferase; ECM4-like subf 92.09
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 92.06
2x64_A 207 Glutathione-S-transferase; detoxification enzyme; 91.99
1tu7_A 208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 91.78
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 91.76
1zl9_A 207 GST class-sigma, glutathione S-transferase 5; glut 91.71
1okt_A 211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 91.24
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 91.17
2wb9_A 211 Glutathione transferase sigma class; thioredoxin f 90.86
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 90.85
1gsu_A 219 GST, CGSTM1-1, class-MU glutathione S-transferase; 90.79
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural 90.64
3gtu_B 224 Glutathione S-transferase; conjugation, detoxifica 90.54
2ycd_A 230 Glutathione S-transferase; SOIL bacteria, herbicid 90.5
1tw9_A 206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 90.45
4hz4_A 217 Glutathione-S-transferase; enzyme function initiat 90.44
2on7_A 206 Nagst-1, Na glutathione S-transferase 1; hookworm; 90.09
2pvq_A 201 Glutathione S-transferase; xenobiotics detoxificat 89.89
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 89.52
2c4j_A 218 Glutathione S-transferase MU 2; glutathione transf 89.36
3iso_A 218 Putative glutathione transferase; GST; HET: GSH; 1 88.95
3lsz_A 225 Glutathione S-transferase; xenobiotic, biodegradat 88.95
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 88.91
1pmt_A 203 PMGST, GST B1-1, glutathione transferase; glutathi 88.59
3c8e_A 288 YGHU, glutathione S-transferase homologue; glutath 88.31
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 88.24
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 87.62
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 87.57
2fhe_A 216 GST, glutathione S-transferase; transferase-substr 87.29
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 87.07
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 87.0
2hnl_A 225 Glutathione S-transferase 1; prostaglandin synthas 86.93
2a2r_A 210 Glutathione S-transferase P; detoxification, nitri 86.77
1n2a_A 201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 86.6
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 86.39
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 86.27
1m0u_A 249 GST2 gene product; flight muscle protein, sigma, t 85.83
3uar_A 227 Glutathione S-transferase; GSH binding site; HET: 85.51
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 85.29
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 85.23
2dsa_A 203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 85.21
4gf0_A 215 Glutathione S-transferase; GST, enzyme function in 85.18
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 85.04
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 84.63
1oe8_A 211 Glutathione S-transferase; schistosomiasis, detoxi 84.56
1kte_A105 Thioltransferase; redox-active center, electron tr 84.5
1dug_A 234 Chimera of glutathione S-transferase-synthetic lin 83.88
4gci_A 211 Glutathione S-transferase; GST, enzyme function in 82.33
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 82.15
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 81.69
3ik7_A 222 Glutathione S-transferase A4; human GST A4-4, enzy 80.77
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 80.3
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
Probab=98.96  E-value=3.9e-10  Score=80.03  Aligned_cols=54  Identities=31%  Similarity=0.502  Sum_probs=35.8

Q ss_pred             CCCeeEEEeecCCCccccCCchhHHHhhhe------eeeeEeeCCCCChhHHhhccCCcc
Q psy15098         23 TNKLKERLASTIDGRRKGACLFCQEYFMDL------LKVTTVDMQKPPPDFRDLYLLKKT   76 (92)
Q Consensus        23 ~~~i~lvvKAgsDg~~lG~CPFcQRlFMiL------f~VTTVD~krKP~~f~dL~p~g~~   76 (92)
                      ..+|+|++||++|+.+.+.||||+|+.|+|      |.+..||+..+|++|++++|.++.
T Consensus        23 ~~~i~l~~ka~~~~~s~~~sP~~~rv~~~L~~~gi~ye~~~v~~~~~~~~~~~~nP~g~V   82 (250)
T 3fy7_A           23 ETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQL   82 (250)
T ss_dssp             --CEEEEEEBCTTSSSBCSCHHHHHHHHHHHHHTCCCEEEEEC--------------CCS
T ss_pred             CCCceEEEEeCCCCCCCCCChHHHHHHHHHHHcCCccEEEECCCccChHHHHhhCCCCCC
Confidence            467999999999999999999999999999      999999999999999999998864



>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.59
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 98.17
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 97.55
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 97.39
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 97.23
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 96.7
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 96.61
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 96.4
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 96.28
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 96.21
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 96.02
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 96.0
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 95.85
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 95.53
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 95.41
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 94.77
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 93.62
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 92.74
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 91.84
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 86.3
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 86.23
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 85.25
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 84.23
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 83.08
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 80.56
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 80.21
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Chloride intracellular channel 1 (clic1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.59  E-value=6e-16  Score=98.39  Aligned_cols=52  Identities=29%  Similarity=0.429  Sum_probs=49.3

Q ss_pred             CeeEEEeecCCCccccCCchhHHHhhhe------eeeeEeeCCCCChhHHhhccCCcc
Q psy15098         25 KLKERLASTIDGRRKGACLFCQEYFMDL------LKVTTVDMQKPPPDFRDLYLLKKT   76 (92)
Q Consensus        25 ~i~lvvKAgsDg~~lG~CPFcQRlFMiL------f~VTTVD~krKP~~f~dL~p~g~~   76 (92)
                      .|++++||++||+++|+||||||+.|+|      |++..||+.++|++|++++|.++.
T Consensus         2 ~i~l~~ka~~dg~~~~~cPf~~rv~~~L~~kgi~~~~~~v~~~~~~~~~~~~nP~~~v   59 (86)
T d1k0ma2           2 QVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGEL   59 (86)
T ss_dssp             CEEEEEEBCTTSSSBCSCHHHHHHHHHHHHHTCCCEEEEECTTSCCHHHHHHCTTCCS
T ss_pred             cEEEEEecCCCcCcCCCCHhHHHHHHHHHHHCCCcEEEEeecccccHHHHHHhccCce
Confidence            5899999999999999999999999999      999999999999999999998764



>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure