Diaphorina citri psyllid: psy15116


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MYTLDDPRQWSESNVAQWLCWAIREFSLEGVTLHQFYMRGKDICSMGKESFLARAPPFMGDILWEHLEILQKEYLVIF
cccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHccc
*YTLDDPRQWSESNVAQWLCWAIREFSLEGVTLHQFYMRGKDICSMGKESFLARAPPFMGDILWEHLEILQKEYLVIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYTLDDPRQWSESNVAQWLCWAIREFSLEGVTLHQFYMRGKDICSMGKESFLARAPPFMGDILWEHLEILQKEYLVIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transforming protein p54/c-ets-1 This protein is the normal cellular product of chicken ETS. In the E26 virus, ETS is responsible for erythroblast transformation.confidentP13474
Protein C-ets-1 Transcription factor.confidentP41156
ETS-like protein pointed, isoform P2/D Required for glial-neuronal cell interactions at the ventral midline which are necessary for the proper elaboration of commissures in the embryonic CNS.confidentP51023

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030578 [BP]PML body organizationprobableGO:0006996, GO:0006997, GO:0009987, GO:0030575, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0000977 [MF]RNA polymerase II regulatory region sequence-specific DNA bindingprobableGO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0051272 [BP]positive regulation of cellular component movementprobableGO:0051270, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0048522
GO:0035295 [BP]tube developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0072358 [BP]cardiovascular system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0072359, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048646 [BP]anatomical structure formation involved in morphogenesisprobableGO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0035259 [MF]glucocorticoid receptor bindingprobableGO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0046677 [BP]response to antibioticprobableGO:0008150, GO:0042221, GO:0050896, GO:0009636
GO:0048729 [BP]tissue morphogenesisprobableGO:0032502, GO:0048856, GO:0009888, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0048870 [BP]cell motilityprobableGO:0040011, GO:0009987, GO:0006928, GO:0051674, GO:0008150, GO:0044763, GO:0051179, GO:0044699
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045648 [BP]positive regulation of erythrocyte differentiationprobableGO:0051094, GO:0050793, GO:0045646, GO:0065007, GO:0032844, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0050794, GO:0045637, GO:0048522
GO:0060429 [BP]epithelium developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JV3, chain A
Confidence level:very confident
Coverage over the Query: 1-74
View the alignment between query and template
View the model in PyMOL