Psyllid ID: psy15118

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVSLVGGASAL
cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHccccccc
ccccHHcHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccHHHHHHHHcc
martkqtarkstggkaprkQLATKAarksapatggvkkphryrpgtVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVSLVGGASAL
martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreIRRYQKSTellirklpfqrLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVSLVGGASAL
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVSLVGGASAL
********************************************GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVSLVG*****
*AR**********************************KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVSLVGGASAL
**************************************PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVSLVGGASAL
**************************************PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVSLVGGAS**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVSLVGGASAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
P84239136 Histone H3 OS=Urechis cau N/A N/A 0.893 0.867 0.991 6e-63
P84237136 Histone H3 OS=Tigriopus c N/A N/A 0.893 0.867 0.991 6e-63
P84235136 Histone H3 OS=Platynereis N/A N/A 0.893 0.867 0.991 6e-63
P02299136 Histone H3 OS=Drosophila yes N/A 0.893 0.867 0.991 6e-63
P84236136 Histone H3 OS=Drosophila N/A N/A 0.893 0.867 0.991 6e-63
P84238136 Histone H3 OS=Chironomus N/A N/A 0.893 0.867 0.991 6e-63
Q28D37136 Histone H3.2 OS=Xenopus t no N/A 0.893 0.867 0.991 6e-63
P84233136 Histone H3.2 OS=Xenopus l N/A N/A 0.893 0.867 0.991 6e-63
P84232136 Histone H3.2 OS=Poroderma N/A N/A 0.893 0.867 0.991 6e-63
P84234136 Histone H3.2 OS=Oncorhync N/A N/A 0.893 0.867 0.991 6e-63
>sp|P84239|H3_URECA Histone H3 OS=Urechis caupo PE=1 SV=2 Back     alignment and function desciption
 Score =  238 bits (608), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 117/118 (99%), Positives = 118/118 (100%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRM 118
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR+
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV 118
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Urechis caupo (taxid: 6431)
>sp|P84237|H3_TIGCA Histone H3 OS=Tigriopus californicus PE=3 SV=2 Back     alignment and function description
>sp|P84235|H3_PLADU Histone H3 OS=Platynereis dumerilii PE=3 SV=2 Back     alignment and function description
>sp|P02299|H3_DROME Histone H3 OS=Drosophila melanogaster GN=His3 PE=1 SV=4 Back     alignment and function description
>sp|P84236|H3_DROHY Histone H3 OS=Drosophila hydei GN=His3 PE=3 SV=2 Back     alignment and function description
>sp|P84238|H3_CHITH Histone H3 OS=Chironomus thummi thummi PE=3 SV=2 Back     alignment and function description
>sp|Q28D37|H32_XENTR Histone H3.2 OS=Xenopus tropicalis GN=TGas081o10.1 PE=2 SV=3 Back     alignment and function description
>sp|P84233|H32_XENLA Histone H3.2 OS=Xenopus laevis PE=1 SV=2 Back     alignment and function description
>sp|P84232|H32_PORAF Histone H3.2 OS=Poroderma africanum PE=1 SV=2 Back     alignment and function description
>sp|P84234|H32_ONCMY Histone H3.2 OS=Oncorhynchus mykiss PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
443683124 248 hypothetical protein CAPTEDRAFT_198870 [ 0.893 0.475 0.991 4e-62
391344312 277 PREDICTED: uncharacterized protein LOC10 0.893 0.425 0.991 6e-62
301628156 255 PREDICTED: histone H3.2-like [Xenopus (S 0.893 0.462 0.991 6e-62
301792130 255 PREDICTED: histone H3.2-like [Ailuropoda 0.893 0.462 0.991 7e-62
301629548 255 PREDICTED: histone H3.2-like [Xenopus (S 0.893 0.462 0.991 7e-62
443688519 245 hypothetical protein CAPTEDRAFT_207719 [ 0.893 0.481 0.991 7e-62
156382552220 predicted protein [Nematostella vectensi 0.893 0.536 0.991 8e-62
449481773 640 PREDICTED: uncharacterized protein LOC10 0.893 0.184 0.991 9e-62
170053486169 Histone H3c [Culex quinquefasciatus] gi| 0.893 0.698 0.991 9e-62
291235844 254 PREDICTED: histone cluster 2, H3c2-like 0.893 0.464 0.991 1e-61
>gi|443683124|gb|ELT87492.1| hypothetical protein CAPTEDRAFT_198870 [Capitella teleta] gi|443717199|gb|ELU08393.1| hypothetical protein CAPTEDRAFT_5792 [Capitella teleta] Back     alignment and taxonomy information
 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 117/118 (99%), Positives = 118/118 (100%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRM 118
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR+
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV 118

Source: Capitella teleta

Species: Capitella teleta

Genus: Capitella

Family: Capitellidae

Order: Capitellida

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota
>gi|391344312|ref|XP_003746445.1| PREDICTED: uncharacterized protein LOC100902368 [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|301628156|ref|XP_002943224.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|301792130|ref|XP_002931030.1| PREDICTED: histone H3.2-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|301629548|ref|XP_002943900.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis] gi|301631762|ref|XP_002944963.1| PREDICTED: histone H3.2-like isoform 1 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|443688519|gb|ELT91191.1| hypothetical protein CAPTEDRAFT_207719 [Capitella teleta] Back     alignment and taxonomy information
>gi|156382552|ref|XP_001632617.1| predicted protein [Nematostella vectensis] gi|156219675|gb|EDO40554.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|449481773|ref|XP_004175940.1| PREDICTED: uncharacterized protein LOC100229139 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|170053486|ref|XP_001862696.1| Histone H3c [Culex quinquefasciatus] gi|167874005|gb|EDS37388.1| Histone H3c [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|291235844|ref|XP_002737853.1| PREDICTED: histone cluster 2, H3c2-like [Saccoglossus kowalevskii] gi|291244665|ref|XP_002742214.1| PREDICTED: histone cluster 2, H3c2-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
FB|FBgn0051613136 His3:CG31613 "His3:CG31613" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0053803136 His3:CG33803 "His3:CG33803" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0053806136 His3:CG33806 "His3:CG33806" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0053809136 His3:CG33809 "His3:CG33809" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0053812136 His3:CG33812 "His3:CG33812" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0053815136 His3:CG33815 "His3:CG33815" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0053818136 His3:CG33818 "His3:CG33818" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0053821136 His3:CG33821 "His3:CG33821" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0053824136 His3:CG33824 "His3:CG33824" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0053827136 His3:CG33827 "His3:CG33827" [D 0.893 0.867 0.991 9.6e-57
FB|FBgn0051613 His3:CG31613 "His3:CG31613" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 584 (210.6 bits), Expect = 9.6e-57, P = 9.6e-57
 Identities = 117/118 (99%), Positives = 118/118 (100%)

Query:     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
             MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct:     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query:    61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRM 118
             LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR+
Sbjct:    61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV 118
GO:0006334 "nucleosome assembly" evidence=ISS
GO:0003677 "DNA binding" evidence=ISS
GO:0000786 "nucleosome" evidence=ISS
GO:0046982 "protein heterodimerization activity" evidence=IEA
FB|FBgn0053803 His3:CG33803 "His3:CG33803" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053806 His3:CG33806 "His3:CG33806" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053809 His3:CG33809 "His3:CG33809" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053812 His3:CG33812 "His3:CG33812" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053815 His3:CG33815 "His3:CG33815" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053818 His3:CG33818 "His3:CG33818" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053821 His3:CG33821 "His3:CG33821" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053824 His3:CG33824 "His3:CG33824" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053827 His3:CG33827 "His3:CG33827" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P84235H3_PLADUNo assigned EC number0.99150.89390.8676N/AN/A
P84234H32_ONCMYNo assigned EC number0.99150.89390.8676N/AN/A
P84237H3_TIGCANo assigned EC number0.99150.89390.8676N/AN/A
P84236H3_DROHYNo assigned EC number0.99150.89390.8676N/AN/A
P84231H32_ICTBUNo assigned EC number0.99150.89390.8676N/AN/A
Q71DI3H32_HUMANNo assigned EC number0.99150.89390.8676yesN/A
P84233H32_XENLANo assigned EC number0.99150.89390.8676N/AN/A
P84232H32_PORAFNo assigned EC number0.99150.89390.8676N/AN/A
Q64400H32_CRILONo assigned EC number0.98300.89390.8676N/AN/A
P84239H3_URECANo assigned EC number0.99150.89390.8676N/AN/A
P84238H3_CHITHNo assigned EC number0.99150.89390.8676N/AN/A
P69078H3_SOLSTNo assigned EC number0.98300.89390.8676N/AN/A
P69079H3_STRDRNo assigned EC number0.98300.89390.8676N/AN/A
Q6LED0H31_RATNo assigned EC number0.98300.89390.8676noN/A
P69072H3_LYTPINo assigned EC number0.98300.89390.8676N/AN/A
P69073H3_PARLINo assigned EC number0.98300.89390.8676N/AN/A
P69071H3_DERIMNo assigned EC number0.98300.89390.8676N/AN/A
P69076H3_PSAMINo assigned EC number0.98300.89390.8676N/AN/A
P69077H3_PYCHENo assigned EC number0.98300.89390.8676N/AN/A
P69074H3_PISBRNo assigned EC number0.98300.89390.8676N/AN/A
P84230H32_CAIMONo assigned EC number0.99150.89390.8676N/AN/A
Q6P823H33_XENTRNo assigned EC number0.95760.89390.8676noN/A
P08898H3_CAEELNo assigned EC number0.95760.89390.8676yesN/A
Q4QRF4H32_DANRENo assigned EC number0.99150.89390.8676yesN/A
Q71LE2H33_PIGNo assigned EC number0.95760.89390.8676yesN/A
P84244H33_MOUSENo assigned EC number0.95760.89390.8676yesN/A
P84245H33_RATNo assigned EC number0.95760.89390.8676noN/A
P84246H33_RABITNo assigned EC number0.95760.89390.8676yesN/A
P84250H33_DROHYNo assigned EC number0.95760.89390.8676N/AN/A
Q28D37H32_XENTRNo assigned EC number0.99150.89390.8676noN/A
P84243H33_HUMANNo assigned EC number0.95760.89390.8676yesN/A
P69075H3_PISOCNo assigned EC number0.98300.89390.8676N/AN/A
P84248H33_SPISONo assigned EC number0.95760.89390.8676N/AN/A
P84249H33_DROMENo assigned EC number0.95760.89390.8676yesN/A
P02299H3_DROMENo assigned EC number0.99150.89390.8676yesN/A
P84227H32_BOVINNo assigned EC number0.99150.89390.8676yesN/A
P84228H32_MOUSENo assigned EC number0.99150.89390.8676yesN/A
P84229H32_CHICKNo assigned EC number0.99150.89390.8676yesN/A
Q6LBE8H32_MUSPANo assigned EC number0.99150.89390.8676N/AN/A
Q6PI20H33_DANRENo assigned EC number0.95760.89390.8676yesN/A
Q6LBF0H31_MUSPANo assigned EC number0.98300.89390.8676N/AN/A
P06352H3_STRPUNo assigned EC number0.97450.89390.8676yesN/A
Q5E9F8H33_BOVINNo assigned EC number0.95760.89390.8676yesN/A
Q6PI79H33_XENLANo assigned EC number0.95760.89390.8676N/AN/A
P68431H31_HUMANNo assigned EC number0.98300.89390.8676yesN/A
P84247H33_CHICKNo assigned EC number0.95760.89390.8676yesN/A
P68433H31_MOUSENo assigned EC number0.98300.89390.8676yesN/A
P68432H31_BOVINNo assigned EC number0.98300.89390.8676yesN/A
P08903H32_ENCALNo assigned EC number0.96610.89390.8676N/AN/A
P22843H3_ACRFONo assigned EC number0.97450.89390.8676N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
PTZ00018136 PTZ00018, PTZ00018, histone H3; Provisional 8e-74
PLN00121136 PLN00121, PLN00121, histone H3; Provisional 3e-65
smart00428105 smart00428, H3, Histone H3 1e-45
PLN00161135 PLN00161, PLN00161, histone H3; Provisional 1e-34
PLN0016097 PLN00160, PLN00160, histone H3; Provisional 4e-27
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 1e-21
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 1e-20
>gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional Back     alignment and domain information 
 Score =  215 bits (550), Expect = 8e-74
 Identities = 112/118 (94%), Positives = 117/118 (99%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP TGG+KKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRM 118
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEA+EAYLVGLFEDTNLCAIHAKR+
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRV 118

Length = 136
>gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|128705 smart00428, H3, Histone H3 Back     alignment and domain information
>gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
PTZ00018136 histone H3; Provisional 100.0
PLN00121136 histone H3; Provisional 100.0
PLN00161135 histone H3; Provisional 100.0
KOG1745|consensus137 100.0
smart00428105 H3 Histone H3. 100.0
PLN0016097 histone H3; Provisional 100.0
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.85
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.67
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 98.81
PTZ00463117 histone H2B; Provisional 98.46
PLN00158116 histone H2B; Provisional 98.38
smart0042789 H2B Histone H2B. 98.27
cd0007685 H4 Histone H4, one of the four histones, along wit 97.98
smart0041774 H4 Histone H4. 97.95
smart0080365 TAF TATA box binding protein associated factor. TA 97.87
PLN00035103 histone H4; Provisional 97.85
PTZ00015102 histone H4; Provisional 97.85
KOG1744|consensus127 97.8
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 97.73
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 97.35
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 97.32
KOG0870|consensus172 97.16
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 96.98
smart0057677 BTP Bromodomain transcription factors and PHD doma 96.41
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 96.4
PF0296966 TAF: TATA box binding protein associated factor (T 95.87
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 95.64
KOG1142|consensus258 94.9
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 93.67
KOG3467|consensus103 91.59
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 89.83
PF0752477 Bromo_TP: Bromodomain associated; InterPro: IPR006 87.97
KOG3334|consensus148 86.21
cd08045212 TAF4 TATA Binding Protein (TBP) Associated Factor 85.72
PF05236 264 TAF4: Transcription initiation factor TFIID compon 83.64
KOG0871|consensus156 83.38
>PTZ00018 histone H3; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.6e-51  Score=305.38  Aligned_cols=123  Identities=91%  Similarity=1.254  Sum_probs=117.6

Q ss_pred             CCCccccccccCCCCCCcchhhhhhhccCCCCCCCCCCCcccCCCchhhHHHhhhhcccchhccccchhHHHHHHHhhhc
Q psy15118          1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (132)
Q Consensus         1 MARtK~~a~k~~g~kaprk~~a~k~~~k~~~~~~~~kk~~r~rpg~~al~EIr~~Qkst~llI~k~pF~rlVreI~~~~~   80 (132)
                      |||||+++++++|+++|+++.++++..++.+..++.++++||+||+++|+|||+||+||+|||||+||+||||||++++.
T Consensus         1 MaRtk~~~~k~~~~~~prk~~~~~~~~~~~~~~~~~~~~~r~rpGt~aLrEIr~yQkst~lLI~k~pF~RLVREI~~~~~   80 (136)
T PTZ00018          1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_pred             CCCCCcCccCCCCCCCCcccccccccccCCCCCCCCCCCcccCCchhHHHHHHHHcccchhccccccHHHHHHHHHHHcC
Confidence            99999999999999999999988877777777778899999999999999999999999999999999999999999999


Q ss_pred             ccccccHHHHHHHHHHHHHHHHHhhhhhhHhhhccCcceeeeh
Q psy15118         81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLV  123 (132)
Q Consensus        81 ~~~r~~~~Al~aLQeaaE~~Lv~lfe~a~l~a~HakRvTi~~~  123 (132)
                      .++|||++||+|||||+|+|||+||||+|+||+||||||||..
T Consensus        81 ~~~rf~~~al~aLQeaaE~yLv~lfed~~lca~HakRVTl~~k  123 (136)
T PTZ00018         81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPK  123 (136)
T ss_pred             CcceeeHHHHHHHHHHHHHHHHHHhhhhHHHHHhhcceecchh
Confidence            9999999999999999999999999999999999999999983

>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>KOG1745|consensus Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>KOG1744|consensus Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>KOG0870|consensus Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>KOG1142|consensus Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG3467|consensus Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) Back     alignment and domain information
>KOG3334|consensus Back     alignment and domain information
>cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site Back     alignment and domain information
>KOG0871|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
2hio_C136 Histone Octamer (Chicken), Chromosomal Protein Leng 5e-64
3av1_A139 The Human Nucleosome Structure Containing The Histo 5e-64
3lel_A136 Structural Insight Into The Sequence-Dependence Of 2e-63
2cv5_A136 Crystal Structure Of Human Nucleosome Core Particle 2e-63
3azh_A139 Crystal Structure Of Human Nucleosome Core Particle 2e-63
3afa_A139 The Human Nucleosome Structure Length = 139 2e-63
2io5_B135 Crystal Structure Of The Cia- Histone H3-H4 Complex 2e-63
3azg_A139 Crystal Structure Of Human Nucleosome Core Particle 6e-63
3azf_A139 Crystal Structure Of Human Nucleosome Core Particle 6e-63
3aze_A139 Crystal Structure Of Human Nucleosome Core Particle 6e-63
3ayw_A139 Crystal Structure Of Human Nucleosome Core Particle 6e-63
1kx3_A135 X-Ray Structure Of The Nucleosome Core Particle, Nc 1e-62
1zla_A135 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 1e-62
1f66_A136 2.6 A Crystal Structure Of A Nucleosome Core Partic 1e-62
3kxb_A135 Structural Characterization Of H3k56q Nucleosomes A 3e-62
4hga_B136 Structure Of The Variant Histone H3.3-H4 Heterodime 4e-62
3av2_A139 The Human Nucleosome Structure Containing The Histo 5e-62
3a6n_A139 The Nucleosome Containing A Testis-Specific Histone 8e-62
1p3m_A135 Crystallographic Studies Of Nucleosome Core Particl 1e-61
1m18_A135 Ligand Binding Alters The Structure And Dynamics Of 3e-61
1p3k_A135 Crystallographic Studies Of Nucleosome Core Particl 4e-61
1p3b_A135 Crystallographic Studies Of Nucleosome Core Particl 4e-61
1p3l_A135 Crystallographic Studies Of Nucleosome Core Particl 5e-61
3c1c_A135 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 5e-61
1p34_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-60
1p3a_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-60
4h9o_A135 Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length 3e-60
4h9n_A135 Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 3e-59
4h9s_A135 Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 3e-58
1id3_A135 Crystal Structure Of The Yeast Nucleosome Core Part 7e-58
4h9p_A135 Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length 1e-53
1aoi_A116 Complex Between Nucleosome Core Particle (H3,H4,H2a 6e-52
3kwq_A98 Structural Characterization Of H3k56q Nucleosomes A 2e-41
1hio_C93 Histone Octamer (Chicken), Chromosomal Protein, Alp 1e-38
2hue_B77 Structure Of The H3-h4 Chaperone Asf1 Bound To Hist 3e-27
4eo5_B76 Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 3e-27
2yfv_A100 The Heterotrimeric Complex Of Kluyveromyces Lactis 2e-24
2yfw_A92 Heterotetramer Structure Of Kluyveromyces Lactis Cs 7e-22
2l5a_A 235 Structural Basis For Recognition Of Centromere Spec 5e-18
3an2_A143 The Structure Of The Centromeric Nucleosome Contain 8e-18
3nqu_A140 Crystal Structure Of Partially Trypsinized (Cenp-AH 9e-18
3r45_A156 Structure Of A Cenp-A-Histone H4 Heterodimer In Com 1e-17
2ly8_A121 The Budding Yeast Chaperone Scm3 Recognizes The Par 1e-15
3nqj_A82 Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Len 3e-12
4ft4_P32 Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 1e-09
3n9p_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 1e-08
3n9n_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P 1e-08
4hsu_C30 Crystal Structure Of Lsd2-npac With H3(1-26)in Spac 1e-08
4gu0_E26 Crystal Structure Of Lsd2 With H3 Length = 26 2e-06
3u5p_I28 Crystal Structure Of The Complex Of Trim33 Phd-Brom 8e-06
2p5b_I22 The Complex Structure Of Jmjd2a And Trimethylated H 1e-05
2x4w_B21 Molecular Basis Of Histone H3k36me3 Recognition By 4e-05
3a1b_A159 Crystal Structure Of The Dnmt3a Add Domain In Compl 4e-05
3kv4_B24 Structure Of Phf8 In Complex With Histone H3 Length 5e-05
3avr_B22 Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H 9e-05
2kft_B21 Nmr Solution Structure Of The First Phd Finger Doma 2e-04
2kwk_B20 Solution Structures Of The Double Phd Fingers Of Hu 2e-04
2uxn_E21 Structural Basis Of Histone Demethylation By Lsd1 R 3e-04
2g46_C21 Structure Of Vset In Complex With Mek27 H3 Pept. An 4e-04
2v1d_C21 Structural Basis Of Lsd1-Corest Selectivity In Hist 4e-04
1m1d_B20 Tetrahymena Gcn5 With Bound Bisubstrate Analog Inhi 8e-04
>pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 Back     alignment and structure 
Iteration: 1

 Score =  238 bits (608), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 117/118 (99%), Positives = 118/118 (100%)
Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRM 118
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR+
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV 118
>pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 Back     alignment and structure
>pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 Back     alignment and structure
>pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 Back     alignment and structure
>pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 Back     alignment and structure
>pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 Back     alignment and structure
>pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 Back     alignment and structure
>pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 Back     alignment and structure
>pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 Back     alignment and structure
>pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 Back     alignment and structure
>pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 Back     alignment and structure
>pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 Back     alignment and structure
>pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 Back     alignment and structure
>pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 Back     alignment and structure
>pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 Back     alignment and structure
>pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 Back     alignment and structure
>pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 Back     alignment and structure
>pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 Back     alignment and structure
>pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 Back     alignment and structure
>pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 Back     alignment and structure
>pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 Back     alignment and structure
>pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 Back     alignment and structure
>pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 Back     alignment and structure
>pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 Back     alignment and structure
>pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 Back     alignment and structure
>pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 Back     alignment and structure
>pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 Back     alignment and structure
>pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 Back     alignment and structure
>pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 Back     alignment and structure
>pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 Back     alignment and structure
>pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 Back     alignment and structure
>pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific Histone H3 Variant By Nonhistone Scm3 Length = 235 Back     alignment and structure
>pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 Back     alignment and structure
>pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 Back     alignment and structure
>pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 Back     alignment and structure
>pdb|2LY8|A Chain A, The Budding Yeast Chaperone Scm3 Recognizes The Partially Unfolded Dimer Of The Centromere-specific Cse4/h4 Histone Variant Length = 121 Back     alignment and structure
>pdb|3NQJ|A Chain A, Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Length = 82 Back     alignment and structure
>pdb|4FT4|P Chain P, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 Peptide And Sah Length = 32 Back     alignment and structure
>pdb|3N9P|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3N9N|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|4HSU|C Chain C, Crystal Structure Of Lsd2-npac With H3(1-26)in Space Group P21 Length = 30 Back     alignment and structure
>pdb|4GU0|E Chain E, Crystal Structure Of Lsd2 With H3 Length = 26 Back     alignment and structure
>pdb|3U5P|I Chain I, Crystal Structure Of The Complex Of Trim33 Phd-Bromo And H3(1-28) K9me3k14ack18ack23ac Histone Peptide Length = 28 Back     alignment and structure
>pdb|2P5B|I Chain I, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 22 Back     alignment and structure
>pdb|2X4W|B Chain B, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 21 Back     alignment and structure
>pdb|3A1B|A Chain A, Crystal Structure Of The Dnmt3a Add Domain In Complex With Histone H3 Length = 159 Back     alignment and structure
>pdb|3KV4|B Chain B, Structure Of Phf8 In Complex With Histone H3 Length = 24 Back     alignment and structure
>pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 Back     alignment and structure
>pdb|2KFT|B Chain B, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 21 Back     alignment and structure
>pdb|2KWK|B Chain B, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3b Bound To A H3 Peptide Wild Type Length = 20 Back     alignment and structure
>pdb|2UXN|E Chain E, Structural Basis Of Histone Demethylation By Lsd1 Revealed By Suicide Inactivation Length = 21 Back     alignment and structure
>pdb|2G46|C Chain C, Structure Of Vset In Complex With Mek27 H3 Pept. And Cofactor Product Sah Length = 21 Back     alignment and structure
>pdb|2V1D|C Chain C, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 21 Back     alignment and structure
>pdb|1M1D|B Chain B, Tetrahymena Gcn5 With Bound Bisubstrate Analog Inhibitor Length = 20 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 1e-37
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 4e-30
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 2e-28
3r45_A156 Histone H3-like centromeric protein A; histone fol 7e-27
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 7e-26
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 1e-20
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 3e-20
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 2e-06
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 1e-04
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 Back     alignment and structure
 Score =  124 bits (310), Expect = 1e-37
 Identities = 117/117 (100%), Positives = 117/117 (100%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 117
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 117
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 Back     alignment and structure
>2x4w_B Histone H3.2; transcription, metal-binding, zinc-finger, chromatin regulator, transcription regulation; HET: M3L; 1.50A {Homo sapiens} PDB: 2x4x_B* 2x4y_B* Length = 26 Back     alignment and structure
>3avr_B Histone H3; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} Length = 26 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 100.0
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 100.0
3r45_A156 Histone H3-like centromeric protein A; histone fol 100.0
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 100.0
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 99.97
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 99.97
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 99.95
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 99.93
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 99.69
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 99.49
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 99.34
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 98.76
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 98.75
2r10_A 361 Chromatin structure-remodeling complex protein RSC 98.41
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 98.33
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 98.26
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 98.24
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 98.23
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 98.23
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 98.12
2jss_A 192 Chimera of histone H2B.1 and histone H2A.Z; histon 98.11
1f1e_A154 Histone fold protein; archaeal histone protein, DN 98.09
1f1e_A154 Histone fold protein; archaeal histone protein, DN 97.9
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 97.83
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 97.73
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 97.73
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 97.67
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 97.65
1taf_A68 TFIID TBP associated factor 42; transcription init 97.64
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 97.63
1taf_B70 TFIID TBP associated factor 62; transcription init 97.46
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 97.13
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 97.06
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 96.98
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 96.54
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 96.3
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 96.19
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 95.37
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 95.36
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 90.8
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 90.51
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 90.3
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 89.3
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 88.55
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 88.06
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 84.81
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 84.54
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 82.05
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
Probab=100.00  E-value=7.3e-55  Score=323.69  Aligned_cols=124  Identities=94%  Similarity=1.262  Sum_probs=81.2

Q ss_pred             CCCccccccccCCCCCCcchhhhhhhccCCCCCCCCCCCcccCCCchhhHHHhhhhcccchhccccchhHHHHHHHhhhc
Q psy15118          1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (132)
Q Consensus         1 MARtK~~a~k~~g~kaprk~~a~k~~~k~~~~~~~~kk~~r~rpg~~al~EIr~~Qkst~llI~k~pF~rlVreI~~~~~   80 (132)
                      ||||||+|++++||++|++++++++++++.|..++.+++|||+||+++|+|||+||+||+|||||+||+||||||+++|.
T Consensus         1 MARtk~tarkstggkaprk~l~~k~a~k~~p~~~~~kk~~r~rpgt~alrEIr~yQkst~lLIpk~PF~RLVREI~~~~~   80 (136)
T 1tzy_C            1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_dssp             -----------------------------------------CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHC
T ss_pred             CCCCccccccCCCCCCCCccccccccccCCCCCCCCCCCCCCCCchhHHHHHHHhhcchhhhhccchHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccHHHHHHHHHHHHHHHHHhhhhhhHhhhccCcceeeehh
Q psy15118         81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIASLVS  124 (132)
Q Consensus        81 ~~~r~~~~Al~aLQeaaE~~Lv~lfe~a~l~a~HakRvTi~~~~  124 (132)
                      +|+|||++||++|||++|+|||+||||+|+||+|+||||||..|
T Consensus        81 ~~~R~q~~Al~aLQeaaEayLv~Lfeda~l~A~HAkRvTi~~kD  124 (136)
T 1tzy_C           81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD  124 (136)
T ss_dssp             TTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHH
T ss_pred             hhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccCcHHh
Confidence            99999999999999999999999999999999999999999833
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d1tzyc_95 a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), 2e-43
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 1e-04
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H3
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

 Score =  136 bits (343), Expect = 2e-43
 Identities = 76/77 (98%), Positives = 77/77 (100%)

Query: 42  YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 101
           YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL
Sbjct: 1   YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 60

Query: 102 VGLFEDTNLCAIHAKRM 118
           VGLFEDTNLCAIHAKR+
Sbjct: 61  VGLFEDTNLCAIHAKRV 77
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 100.0
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 98.9
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 98.67
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 98.57
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 98.49
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 98.01
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 97.65
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 97.59
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 97.5
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 97.4
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 97.37
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 97.03
d1q9ca_172 Histone domain of Son of sevenless protein {Human 95.97
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 95.56
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 95.37
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 95.22
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 88.39
d1q9ca_172 Histone domain of Son of sevenless protein {Human 84.93
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H3
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

Probab=100.00  E-value=1.2e-42  Score=242.78  Aligned_cols=86  Identities=90%  Similarity=1.239  Sum_probs=82.8

Q ss_pred             cCCCchhhHHHhhhhcccchhccccchhHHHHHHHhhhcccccccHHHHHHHHHHHHHHHHHhhhhhhHhhhccCcceee
Q psy15118         42 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRMIAS  121 (132)
Q Consensus        42 ~rpg~~al~EIr~~Qkst~llI~k~pF~rlVreI~~~~~~~~r~~~~Al~aLQeaaE~~Lv~lfe~a~l~a~HakRvTi~  121 (132)
                      ||||+++++|||+||+||++||||+||+||||||++++.+++|||++||++||||+|+|||+||||||+||+|+||||||
T Consensus         1 ~rpGt~ALrEIRk~Qkst~lLIpk~pF~RLVRei~~~~~~~~r~~~~Al~aLQea~E~yLv~lfeda~~~a~HakRvTl~   80 (95)
T d1tzyc_           1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM   80 (95)
T ss_dssp             CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHCTTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEEC
T ss_pred             CCCchHHHHHHHHHhCCcccccccccHHHHHHHHHHhcCCCCEeeHHHHHHHHHHHHHHHHHHHHHhHHHHHhcCCCcCC
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             e--hhhcc
Q psy15118        122 L--VSLVG  127 (132)
Q Consensus       122 ~--~~~~~  127 (132)
                      .  |.|++
T Consensus        81 ~kD~~Lar   88 (95)
T d1tzyc_          81 PKDIQLAR   88 (95)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            9  55554
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure